KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0582Help
Entry
SeSA_A0582        CDS       T00743                                 

Gene name
cysS
Definition
(GenBank) cysteinyl tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sew00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SeSA_A0582 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sew01007]
    SeSA_A0582 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sew03016]
    SeSA_A0582 (cysS)
Enzymes [BR:sew01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     SeSA_A0582 (cysS)
Amino acid related enzymes [BR:sew01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   SeSA_A0582 (cysS)
Transfer RNA biogenesis [BR:sew03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SeSA_A0582 (cysS)
 Prokaryotic Type
    SeSA_A0582 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 Mut7-C
Motif
Other DBs
NCBI-ProteinID: ACF88791
UniProt: B4TN59
Position
586188..587573
Genome map
AA seq 461 aa AA seqDB search
MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYK
LKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHQDFDALNILRPDSEPRATHHIQE
IIELTRTLIEKGHAYVADNGDVMFDVPTDPTYGQLSRQDLEQLQAGARVDVVDVKRNPMD
FVLWKMSKEGEPSWPSPWGEGRPGWHIECSAMNCKQLGNHFDIHGGGSDLMFPHHENEIA
QSTCAHDGEYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRS
QLNYSEENLKQARASLERLYTALRGTDKSAAPAGGEAFEARFVEAMNDDFNTPEAYSVLF
DMAREVNRLKGEDMTAANAMASHLRKISGVLGLLEQEPDVFLQSGAQADDGEVAEIEALI
QQRLDARKAKDWAAADAARDRLTEMGIILEDGPQGTTWRRK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaatttttaatacactgacgcgccaaaaagaggaattcaaacccattcatgcc
ggggaagtcggcatgtacgtgtgtggtatcaccgtttacgatctctgccacattggccac
ggacgcacgtttgtcgcttttgacgttgtcgcgcgctatttgcgttttctcggttataag
ctgaagtatgtgcgtaacattaccgatatcgacgataaaattattaaacgcgccaatgaa
aacggcgaaagttttgtcgcgctggtcgacagaatgattgcggaaatgcatcaggacttt
gacgcgctgaatattctgcgtccggacagcgagccgcgtgcgacgcaccatattcaggaa
attatcgagctcacccgcaccttaatcgagaaagggcacgcctatgtggcggataacggc
gatgtgatgttcgatgtaccgaccgatccgacttatgggcagctttcccgtcaggatctt
gagcagcttcaggcgggcgcgcgcgtggatgtcgttgacgtgaagcgtaacccgatggac
ttcgtgctgtggaaaatgtcgaaagagggcgagccgagctggccgtcgccgtggggcgaa
gggcgtccgggctggcacattgaatgttcggcaatgaactgtaagcagttgggcaaccat
tttgatattcacggcggtggttccgatctgatgttcccgcaccatgaaaacgagattgcc
cagtctacctgcgcccacgacggcgaatacgtcaactactggatgcactccggtatggtg
atggtggatcgcgagaagatgtccaaatcgttgggcaacttctttaccgtgcgcgacgtg
ctgaaatactacgatgcggaaaccgtgcgctacttcctgatgtccgggcattaccgtagc
caactgaactacagcgaagagaacctcaagcaggcgcgcgcctcgctggagcggctatac
actgcattgcgtggaacggataaatcagcggccccggcgggcggcgaggcgtttgaagcg
cgtttcgtcgaggcgatgaatgacgatttcaatacgccggaagcctactccgtcctgttt
gatatggcgcgtgaagtcaaccgtctgaagggcgaagatatgaccgccgcgaatgcgatg
gcgtctcatctgcggaagatttccggcgtgctgggactgctggaacaggagccggatgtt
ttcctgcaaagcggcgcgcaggcggatgacggtgaagttgcggaaattgaagccttgatt
caacagcgtctggatgcccgtaaagcgaaagactgggcggcggcggacgcggcgcgcgat
cgtctcactgaaatgggtattattctggaagatggcccgcagggcaccacctggcgacgt
aagtaa

DBGET integrated database retrieval system