KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0587Help
Entry
SeSA_A0587        CDS       T00743                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00670  One carbon pool by folate
sew01100  Metabolic pathways
sew01120  Microbial metabolism in diverse environments
sew01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sew00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SeSA_A0587 (folD)
Enzymes [BR:sew01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SeSA_A0587 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SeSA_A0587 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACF92301
UniProt: B4TN64
Position
complement(589755..590621)
Genome map
AA seq 288 aa AA seqDB search
MAAKIIDGKTIAQQVRSEVAQKVQARVAAGLRAPGLAVVLVGSNPASQIYVASKRKACDE
VGFVSRSYDLPETTSEAELLALIDTLNADNTIDGILVQLPLPAGIDNVKVLERIAPDKDV
DGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTYGLNAVVIGASNIVGRPMSMELL
LAGCTTTVTHRFTKDLRHHVEHADLLIVAVGKPGFIPGEWIKEGAIVIDVGINRLENGKV
VGDVVFDEAAARASYITPVPGGVGPMTVATLIENTLQACIEYHDPQGK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaagattattgacggtaaaacgattgcgcagcaggtgcgatctgaggttgct
caaaaagttcaggcacgcgtcgcagcagggcttcgcgctcccggcctggctgtggtgctg
gtcggcagcaatccggcctcacagatttatgtcgcaagcaaacgtaaagcgtgcgacgaa
gtgggattcgtctcccgctcctatgacctgccagaaaccaccagcgaagccgaactgctg
gcgcttatcgatactctgaatgcagataacacgattgacggtattctggtgcagttgcct
ttaccggcaggtatcgacaacgttaaagtgctggagcgtatcgcgccagataaagacgta
gacggttttcatccttataatgtcggtcgtctgtgtcagcgtgcgccacgcctgcgtccc
tgtacgccccgcggtattgtgaccctgcttgagcgttacaacattgatacctacggcctg
aatgcggtggtcattggcgcgtccaatatcgttggacgcccaatgagcatggagctgctg
ctggctggctgtacgactaccgttacgcaccgctttaccaaagatctgcgtcaccatgtt
gagcatgctgatttgctcattgtcgccgtaggtaaaccgggctttattcccggcgaatgg
attaaagaaggcgcaattgtgattgatgtcggtattaaccgtctggaaaatggcaaggtc
gttggcgacgtcgtgtttgacgaagccgcggcgcgcgcgtcatacatcacgccagttccg
ggcggcgtcggcccgatgacggtcgccacgcttatcgaaaacacgctgcaggcgtgcatt
gaatatcacgatccacaaggaaaataa

DBGET integrated database retrieval system