KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A1391Help
Entry
SeSA_A1391        CDS       T00743                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00450  Selenocompound metabolism
sew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sew00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SeSA_A1391 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sew03016]
    SeSA_A1391 (selD)
Enzymes [BR:sew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     SeSA_A1391 (selD)
Transfer RNA biogenesis [BR:sew03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    SeSA_A1391 (selD)
 Prokaryotic Type
    SeSA_A1391 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ACF90622
UniProt: A0A0N1QW94
Position
1342281..1343324
Genome map
AA seq 347 aa AA seqDB search
MSEQAIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSIISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINTLSPDIARE
VTEGGRFACRQAGIALAGGHSIDAPEPIFGLAVTGVVPTERVKKNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHQGLATEVMCRMNVAGAAFANIDGVKAMTDVTGFGLLGHLSEM
CQGAGVQALLCYQDIPKLPGVEEYIALGAVPGGTERNFASYGHLMGDMSREVRSLLCDPQ
TSGGLLLAVTPDAEDDVKATAAEFGIDLTAIGELVEARGGRAMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaagccattcgtttaacgcaatacagccacggcgctggttgcggttgtaaa
atttcccctaaagtgctggagactatcctgcatagcgagcaggcgaagttcgtcgacccg
aatctgctggtgggtaatgaaacccgcgatgatgcggcggtttacgatctgggtaatggc
accagtattatcagcaccaccgacttctttatgccgatagtcgacaacccgttcgatttt
ggccgcattgcggcaacaaacgccatcagcgatatttttgcgatgggcggcaaaccgatt
atggcgatcgcgatccttggctggccgattaataccctgtcgcccgatattgcgcgtgaa
gtgaccgagggggggcgctttgcctgccgtcaggccggtatcgcgctggcgggcggacac
tctattgacgccccggagccgatctttggtctcgcggtcacaggcgtagtgccgaccgaa
cgggtgaagaaaaacagtaccgcgcaggcgggatgcaaactctttctgaccaaaccgttg
gggattggcgtgttgaccaccgccgagaaaaaatcgctgcttaaacctgaacatcagggg
ctggcgacggaagtcatgtgtcggatgaacgttgctggcgcggcgtttgccaatatcgat
ggcgtaaaagccatgactgacgttaccggttttggcctgctggggcacctgagcgagatg
tgccagggcgcaggcgtgcaggcgctgctttgctatcaggacatccctaaactgccgggt
gtggaagagtatattgccctgggcgccgtaccgggcggcacagagcgcaacttcgccagc
tatggtcatctgatgggcgacatgtcgcgtgaagttcgtagcctgctgtgcgatccgcaa
acgtcaggcggtctgttgttggcggtaacgccggacgccgaagacgatgttaaagccacc
gcggcggaatttggtatcgatctgaccgcgattggcgaactggtcgaggcccgcggcggt
cgcgctatggttgagattcgttaa

DBGET integrated database retrieval system