KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A2310Help
Entry
SeSA_A2310        CDS       T00743                                 

Definition
(GenBank) undecaprenyl-phosphate galactose phosphotransferase
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Brite
KEGG Orthology (KO) [BR:sew00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sew01005]
    SeSA_A2310
Enzymes [BR:sew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     SeSA_A2310
Lipopolysaccharide biosynthesis proteins [BR:sew01005]
 O-antigen
  SeSA_A2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf CoA_binding_3 CENP-L DUF2633
Motif
Other DBs
NCBI-ProteinID: ACF89540
UniProt: A0A0N1QTZ1
Position
complement(2180209..2181639)
Genome map
AA seq 476 aa AA seqDB search
MDNIDNKYNPQLCKIFLAISDLIFFNLALWFSLGCVYFIFDQVQRFIPQDQLDTRVITHF
ILSVVCVGWFWIRLRHYTYRKPFWYELKEIFRTIVIFAIFDLALIAFTKWQFSRYVWVFC
WTFAIILVPFFRALTKHLLNKLGIWKKKTIILGSGQNARGAYSALQSEEMMGFDVIAFFD
TDASDAEINMLPVIKDTEIIWDLNRTGDVHYILAYEYTELEKTHFWLRELSKHHCRSVTV
VPSFRGLPLYNTDMSFIFSHEVMLLRIQNNLAKRSSRFLKRTFDIVCSIMILIIASPLMI
YLWYKVTRDGGPAIYGHQRVGRHGKLFPCYKFRSMVMNSQEVLKELLANDPIARAEWEKD
FKLKNDPRITAVGRFIRKTSLDELPQLFNVLKGDMSLVGPRPIVSDELERYCDDVDYYLM
AKPGMTGLWQVSGRNDVDYDTRVYFDSWYVKNWTLWNDIAILFKTAKVVLRRDGAY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggataatattgataataagtataatccacagctatgtaaaatttttttggctatatcg
gatttgattttttttaatttagccttatggttttcattaggatgtgtctattttattttt
gatcaagtacagcgatttattcctcaagaccaattagatacaagagttattacacatttt
attttgtcagtagtatgtgtcggttggttttggattcgtttgcgacattatacataccgc
aagccattttggtatgagttaaaagaaatttttcgtacgatcgttatttttgctatattt
gatttggctctgatagcgtttacaaaatggcagttttcacgctatgtctgggtgttttgt
tggacttttgctataatcctggtgcctttttttcgcgcacttacaaagcatttattgaac
aagctaggtatctggaagaaaaaaactatcatcctggggagcggacagaatgctcgtggt
gcatattctgcgctgcaaagtgaggagatgatggggtttgatgttatcgctttttttgat
acggatgcgtcagatgctgaaataaatatgttgccggtgataaaggatactgagattatt
tgggatttaaatcgtacaggtgatgtccattatatccttgcttatgaatacaccgagttg
gagaaaacacatttttggctacgtgaactttcaaaacatcattgtcgttctgttactgta
gtcccctcgtttagaggattgccattatataatactgatatgtcttttatctttagccat
gaagttatgttattaaggatacaaaataacttggctaaaaggtcgtcccgttttctcaaa
aggacatttgatattgtttgttcaataatgattcttataattgcatcaccacttatgatt
tatctgtggtataaagttactcgagatggtggtccggctatttatggtcatcagcgagta
ggtcggcatggaaaactttttccatgctacaaatttcgttctatggttatgaattctcaa
gaggtactaaaagaacttttggctaacgatcctattgccagggctgaatgggaaaaagat
tttaaactgaaaaatgatcctcgaatcacagctgtaggtcgatttatacgtaaaactagc
cttgatgagttgccacaactttttaatgtactaaaaggtgatatgagcctggttggacca
cgacctatcgtttcggatgaactggagcgttattgtgatgatgttgattattatttgatg
gcaaagccgggcatgacaggtctatggcaagtgagtgggcgtaatgatgttgattatgac
acccgtgtttattttgattcctggtatgttaaaaactggacgctttggaatgatattgcc
attctgtttaaaacagcgaaagttgttttgcggcgagatggtgcgtattaa

DBGET integrated database retrieval system