KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3124Help
Entry
SeSA_A3124        CDS       T00743                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Brite
KEGG Orthology (KO) [BR:sew00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sew03016]
    SeSA_A3124
Enzymes [BR:sew01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     SeSA_A3124
Transfer RNA biogenesis [BR:sew03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    SeSA_A3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ACF89499
UniProt: A0A0N1QTW4
Position
complement(3019820..3020602)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDQWLVAVNKPAGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRRLAQQFEQHHIRKRYHAIVRGWLMDDAVLDYPLVEERDKIADKFAREDK
APQPAVTQYRGLATVEMAVPTGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSAAEHFACRRLMLHASRLELTHPFTGQPLMIQAGLDETWMQALTQFGWRGLL
PDNERVEFTAASRQDETHQA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatcctctatcaagaccagtggctggttgccgtgaataaacccgcaggctgg
cttgttcaccggagctggctggatcgcgacgaaaaagtcgtggtcatgcaaacggtgcgc
gaccaaatcggccagcatgtttttaccgcccaccgtctcgacagacccacgtcgggcgta
ctgttaatggggctgtccagcgaagcgggacgccgtctggcgcagcagttcgagcagcac
cacatccgtaaacgctaccatgccattgtgcgcggctggctgatggatgacgcagtactg
gattatccgctggtggaagagcgcgataaaattgctgataaattcgcccgcgaggataaa
gcgccccagccggctgtaacgcagtatcgcggactggcgacggtcgaaatggcggtgccg
accggacgttatcccaccacgcgttatggtctggttgagctggaaccaaaaacgggacgc
aagcaccagcttcgtcgtcatctggcgcatctgcgtcatcctatcatcggcgacagcaag
catggcgatttgcgacaaaaccgcagcgccgcagagcattttgcctgtcgtcgcctgatg
cttcatgccagtcggcttgaactgacgcaccccttcaccggacagccgttgatgattcag
gccgggttggatgaaacctggatgcaggcgctgacacagtttggctggcgtggacttctc
cctgacaatgaaagggttgagtttacggcggcgtcccggcaggatgagactcatcaggca
taa

DBGET integrated database retrieval system