KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3159Help
Entry
SeSA_A3159        CDS       T00743                                 

Gene name
recC
Definition
(GenBank) exodeoxyribonuclease V, gamma subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sew00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SeSA_A3159 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sew03400]
    SeSA_A3159 (recC)
Enzymes [BR:sew01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SeSA_A3159 (recC)
DNA repair and recombination proteins [BR:sew03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SeSA_A3159 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: ACF92293
UniProt: A0A0N1QZU7
Position
complement(3056988..3060359)
Genome map
AA seq 1123 aa AA seqDB search
MLRVYHSNRLDVLEALMEFIVERERLDDPFEPEMILVQSTGMAQWLQMTLSQKFGIAANI
AFPLPASFIWEMFVRVLPDIPKESAFSKQSMSWKLMTLLPQLLDKDEFVLLRHYLTDDTD
KRKLFQLSARAADLFDQYLVYRPDWLTQWEAGKSVEGLGEAQNWQALLWKALVEYTAALG
QPRWHRANLYQRFIQTLESATACPPGLPSRVFICGISALPPVYLRALQALGKHIEIHLLF
TNPCRYYWGDIKDPAWLAKLMARQRRHSFEDRHLPLFRENQNPEALFNSDGEQDIGNPLL
ASWGKLGRDYIYLLSELENSQELDAFVDITPDNLLHRIQADILELESHAVAGVNLEEYSR
SDNKRLLDPEDNSLSFHVCHSPQREVEILHDRLLAMLEADPTLTPRDIIVMVADIDSYSP
FIQAVFGSAPTERYLPYAISDRRARQSHPVLQAFISLLSLPDSRFVSEDVLALLDVPVLA
ARFTINEEGLRYLRLWVNESGIRWGIDDDNVRELELPATGQHTWQFGLTRMLLGYAMESA
QGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWRRGLAQERPLEEWLPVCRDMLNDFFL
PDADTEAAMTLIEQQWQAIIAEGVAAEYGDAVPISLLRDELAQRLDQERISQRFLAGPIN
ICTLMPMRSIPFRVVCLLGMNDGVYPRQLAPLGFDLMSQKPMRGDRSRRDDDRYLFLEAL
ISAQQTLYISYIGRSIQDNSERFPSVLVQELVDYIGQSHYLPGDETLTCDESEARVKAHI
TRLHTRMPFDAQNYQPGEQQSYAREWLPAASQSGKAHSDFVQPLSFTMPETLTLESLQRF
WAHPVRAFFQMRLQVNFRSEESEIPDAEPFELEGLTRYQLNQQLLNTLVEEDDAERLFRR
FRAAGELPYGAFGEIFWDAQCQEMQQLASRVIACRKPSQSLEVDLLCNGVQLTGWLPQVQ
EDGLLRWRPALISVAQGVQLWLEHLVYCASGGSGESRLFLRKEGEWRFPPLDKAQAMAYL
AQLIEGYREGMSSPLLVLPESGGAWIKACYDAENDVMLDDDDTLQKARTKFLLAYEGNMM
VSGEGEDIWYQRLWRQLESETLQAIIAQSRHYLLPLFRFNQSR
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgttaagggtctaccactccaatcgtctggatgtgctggaagcgttgatggagttcatc
gtcgaacgcgagcggctggatgatccctttgaaccagaaatgattctggttcaaagcacg
ggtatggcgcagtggctgcagatgaccctttcacaaaagtttggtattgcggcgaatatc
gcttttccgttaccggcgagttttatctgggagatgtttgtccgcgtgttgccggatatc
cccaaagaaagcgctttcagcaaacaaagcatgagctggaaactgatgaccttgctgcca
cagttgctggataaggatgagtttgtactgctgcgccattatctgaccgacgacaccgat
aaacgcaaactctttcagctttccgcgcgcgctgccgacctgttcgatcagtatctggtt
tatcggcctgactggcttacgcagtgggaagcaggaaaaagcgtggaaggtctgggggag
gcgcaaaactggcaggcgctgctgtggaaagcattggtggaatataccgccgcgctgggg
cagccacgctggcatcgcgccaatctctaccaacgctttattcaaacgctggaaagcgcg
accgcctgcccgccagggttgccgtcccgcgtttttatttgcggcatttccgcgttaccg
ccagtgtatctcagagcgttgcaggcgctgggcaaacatattgaaatccatctccttttt
actaatccgtgtcggtattactggggggacattaaagacccagcctggctggcaaaactc
atggcccgccagcgtcgtcacagttttgaagaccgtcatttaccgttgttccgtgaaaac
cagaatccggaagccttgtttaacagcgacggcgaacaggatatcggtaatccgctactg
gcctcatggggaaaactggggcgggattatatctacctgctatctgaactggaaaacagc
caggagctggatgcgtttgttgatattacgccagataatcttttgcatcggattcaggcg
gatattcttgaactggaaagccatgcggtggcgggcgtaaatcttgaggagtattcgcgc
agcgacaataagcgtctgctcgatcctgaggataacagcctctcttttcacgtttgtcac
agcccgcagcgcgaggtggaaatactgcacgatcgcctgctggcgatgctggaagccgat
ccgacactaacgccgcgcgacattatcgttatggtggctgatattgacagctatagcccg
tttatccaggcggtatttggtagcgcgccaacggagcgctatctgccttatgccatttcc
gatcggcgggcgcgtcagtcacatccggtgttacaggcatttatcagcctactttcgtta
ccggacagccgcttcgtctccgaggatgttctggcgttgttagacgtaccggtattggct
gcccgctttacgatcaacgaagaagggctgcgttatttgcgcttgtgggtcaatgagtca
ggcattcgctggggaattgacgatgacaacgtacgcgagctggaacttcctgccacggga
cagcatacatggcaatttggcctgacgcgtatgctgctggggtatgccatggaaagcgcc
cagggcgagtggcagtcggttctgccttatgacgaatccagcggtctgattgctgagctg
gtcgggcatctggcttcgctgctgatgcagcttaatatctggcggcgcggtctggcgcag
gagcgaccgctggaagagtggttgcccgtttgtcgcgacatgctcaatgatttcttcctg
cccgatgcggacacggaagcggcaatgacattgattgaacagcagtggcaggccattatc
gccgaaggcgtcgcggcggaatatggcgacgcggtaccgatttcgctactgcgggatgaa
ctggcgcagcgtctggatcaggaacgtattagccagcgcttcctggcgggccccatcaat
atttgtacgctgatgccgatgcgttccattccgttcagagtcgtttgcctgctgggaatg
aacgacggcgtatacccgcgccagcttgcgccgttgggctttgacctgatgagccaaaaa
cccatgcgcggggatcgtagccgtcgcgacgatgaccgatacctgtttctggaagcgtta
atctcggcgcagcagacgctgtatatcagctacatcggtcgctccatccaggataatagc
gaacgctttccctctgtactggtgcaagaattggtggattacatcggacaaagccactat
ttgccgggcgacgaaacgctgacctgtgatgagagcgaagcacgagtcaaagcgcatatt
acgcgtctgcatacccgtatgccttttgatgcgcaaaattaccaacccggcgaacagcaa
agttatgccagagagtggttgcccgcggcgagtcagtcgggaaaagcgcattctgacttt
gtgcagccgctttcttttacgatgccggaaacattgactctggaaagtctgcagcgtttt
tgggcccatccggtacgcgcattttttcagatgcggcttcaggttaatttccgctcggaa
gagagtgagattcctgatgcggaaccgtttgaattagagggattgacgcgatatcaactt
aaccaacagttgctcaatacgctggttgaagaggacgacgccgaacgcttgttccgccgt
ttccgggctgcgggagagttgccttacggcgcgtttggcgaaatattctgggatgcgcaa
tgccaggagatgcagcaactggcaagccgggtcatcgcctgtcgtaagccgagccaaagc
ctggaagtggatctgctttgcaatggcgttcagctaaccggctggctaccgcaggtacag
gaggatggattattgcgctggcgtcccgctttaatcagcgttgcgcaaggtgtgcaactt
tggctggaacaccttgtctattgtgccagcggcgggagtggcgaaagtcgtctgtttttg
cgcaaagagggagaatggcgatttccgccacttgataaagcgcaggcaatggcttacctg
gcgcaactgattgaaggctaccgggaaggcatgtcttctccgctattggtactgccggaa
agcggcggcgcatggataaaagcctgttatgacgctgaaaatgatgtcatgttagacgat
gatgataccttacagaaggccaggacaaagtttttactggcttatgaaggcaacatgatg
gtgagcggcgaaggcgaagatatctggtatcaacgtctttggcgtcagctggaatctgaa
acgttgcaggctatcattgcgcagtcccgacattacctgttaccgctgtttcgttttaat
cagtctcgttga

DBGET integrated database retrieval system