KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3188Help
Entry
SeSA_A3188        CDS       T00743                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00071  Fatty acid degradation
sew00280  Valine, leucine and isoleucine degradation
sew00310  Lysine degradation
sew00362  Benzoate degradation
sew00380  Tryptophan metabolism
sew00620  Pyruvate metabolism
sew00630  Glyoxylate and dicarboxylate metabolism
sew00640  Propanoate metabolism
sew00650  Butanoate metabolism
sew00900  Terpenoid backbone biosynthesis
sew01100  Metabolic pathways
sew01110  Biosynthesis of secondary metabolites
sew01120  Microbial metabolism in diverse environments
sew01130  Biosynthesis of antibiotics
sew01200  Carbon metabolism
sew01212  Fatty acid metabolism
sew02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeSA_A3188
   00630 Glyoxylate and dicarboxylate metabolism
    SeSA_A3188
   00640 Propanoate metabolism
    SeSA_A3188
   00650 Butanoate metabolism
    SeSA_A3188
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SeSA_A3188
   00072 Synthesis and degradation of ketone bodies
    SeSA_A3188
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SeSA_A3188
   00310 Lysine degradation
    SeSA_A3188
   00380 Tryptophan metabolism
    SeSA_A3188
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SeSA_A3188
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SeSA_A3188
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SeSA_A3188
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sew04147]
    SeSA_A3188
Enzymes [BR:sew01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SeSA_A3188
Exosome [BR:sew04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SeSA_A3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACF92724
UniProt: A0A0N1R0S9
Position
complement(3083932..3085110)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLAEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtactgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgacaaccgtttcc
gccattaccattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttatcgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgatagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagctctgctgcacccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactggcggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcagtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcctattggcgcttccggctgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggcctggcgacgctgtgtattggt
ggcggccagggcgttgctttaaccattgaacgcgattga

DBGET integrated database retrieval system