KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3308
Entry
SeSA_A3308        CDS       T00743                                 

Definition
(GenBank) putative cytoplasmic protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sew00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeSA_A3308
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sew02044]
    SeSA_A3308
Secretion system [BR:sew02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeSA_A3308
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACF89579
UniProt: A0A0N1QU22
Position
complement(3190967..3191452)
AA seq 161 aa
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTK
FVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKP
VETMSLNFTKIEWQITAEKSDGAQQESRTSVWDLAMDQIGK
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgcgatttttttaaagctcgacaatatcaaaggcgaaagccaggttgaaggcttt
gaagatcagatagagatcatgtcttatagccacaatgtggcaatgcaggtaaataacgat
gttagcctcactgagcggacttccgggcgtgcgcatgttggtgaaatgtcgctcaccaaa
tttgtcgacctcgccacgcctgtgctcaatgagtactgctgtagcgggaggctaattaga
accgcggtgctgacgttgtgccgcaatgacgacggcaaaatgcggtcgcttatcgtttat
accctgacaaacgtgctgatatcacaactcagtgttagcggcggcgccggcggtaagccg
gtggaaacgatgtcgctgaacttcacgaaaatcgaatggcaaatcactgccgagaaatca
gacggcgctcaacaggagtccagaacgtcagtatgggatctggcgatggaccagataggg
aaatga

DBGET integrated database retrieval system