KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4217Help
Entry
SeSA_A4217        CDS       T00743                                 

Gene name
glnL
Definition
(GenBank) nitrogen regulation protein NR
  KO
K07708  two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC:2.7.13.3]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sew00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SeSA_A4217 (glnL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sew01001]
    SeSA_A4217 (glnL)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sew02022]
    SeSA_A4217 (glnL)
Enzymes [BR:sew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SeSA_A4217 (glnL)
Protein kinases [BR:sew01001]
 Histidine kinases
  NtrC family
   SeSA_A4217 (glnL)
Two-component system [BR:sew02022]
 NtrC family
  GlnL-GlnG (nitrogen regulation)
   SeSA_A4217 (glnL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS PAS_4 PAS_8 PAS_9 DUF1688 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ACF90889
UniProt: A0A0N1QWW1
Position
complement(4092612..4093661)
Genome map
AA seq 349 aa AA seqDB search
MASGIQPDAGQILNSLINSVLVVDDALAIHYANPAAQQLLAQSSRKLFGTPLPELLSYFS
LNIDLMRESLAAGQGFTDNEVTLVIDSRSHILSLTAQRLPDDFILLEMAPMDNQRRLSQE
QLQHAQQIAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPALTEYTKVIIEQADRLRN
LVDRLLGPQHPGMHITESIHKVAERVVALVSMELPDNVRLIRDYDPSLPELPHDPEQIEQ
VLLNIVRNALQALGPEGGEITLRTRTAFQLTLHGERYRLAARIDVEDNGPGIPPHLQDTL
FYPMVSGREGGTGLGLSIARNLIDQHAGKIEFTSWPGHTEFSVYLPIRK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcggcatacagcccgatgctgggcagatcctcaattcgttaatcaacagcgtg
ctggtggtcgacgacgcgctggcaatccattacgccaaccctgccgcgcagcagttgctc
gcgcaaagctcacgcaaactgttcgggacgccgttacctgaactgttgagctatttttcg
ttaaacattgacctgatgcgcgaaagtttagcggcagggcaaggctttaccgataacgaa
gtgacgctggtgattgatagtcgctcgcatattctctctttgaccgcccaacgtctgccc
gacgattttatactgctcgaaatggcgccgatggataaccagcgtcgtctgagtcaggag
cagttgcagcacgcgcagcaaatcgccgcccgcgatctggtgcgcggtctggcacacgaa
atcaaaaatccgctcggcggcctgcgcggcgcggcgcagctactcagcaaggcgctgccc
gacccggcgctaacggaatataccaaagtcatcattgaacaggccgacaggctacgcaac
cttgtcgatcgtttgctggggccgcagcacccgggaatgcacattaccgagagcatacat
aaagtcgcggagcgcgtggtggcgctggtgtcgatggaactgccggataatgtccggctt
atccgcgattacgaccccagtctgccagaactgccgcacgacccggaacaaattgagcaa
gtactgctgaatattgtccgcaatgccttgcaggcgctggggccggaaggcggcgaaatt
acgctgcgtacccgtaccgccttccagttaacgctgcatggcgaacgctatcgcctggcg
gcgcgtatagacgttgaagacaatgggccgggcattcctccccatttacaggatacgctg
ttctacccgatggtcagcggtcgcgaaggcggcaccgggcttgggttatctatcgcccgc
aatcttatcgatcaacacgccggcaaaattgaatttaccagttggccggggcataccgag
ttttcggtttacctgccgattcggaaatag

DBGET integrated database retrieval system