KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4325Help
Entry
SeSA_A4325        CDS       T00743                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00561  Glycerolipid metabolism
sew00640  Propanoate metabolism
sew01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sew00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SeSA_A4325
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SeSA_A4325
Enzymes [BR:sew01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SeSA_A4325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: ACF92536
UniProt: A0A0N1R0D7
Position
complement(4197470..4198573)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGANVIARLGDYLKPMANNWLVVGDKFVLGFAEETLRKSLTDAGLSVE
IAPFGGECSQNEIDRLRAVAEKSQCGAVLGIGGGKTLDTAKALAHFMNVPVAIAPTIAST
DAPCSALSVIYTDAGEFDRYLLLPHNPNMVIVDTQIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLIEEGEKAMLAAEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAIHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALC
HSVGLPITLAQLDIKQDIPAKMRTVAEASCAEGETIHNMPGGATPDEVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattattcagtcaccaggtaagtatattcagggtgcaaacgtcatcgcgcgt
cttggcgattatttaaaaccaatggcgaacaactggctggttgtgggcgataaattcgtg
ctgggatttgccgaagagacgctgcgcaaaagcctgacggatgccggtttgtcagtagaa
atcgccccgtttggcggcgaatgttcgcaaaatgagatcgacaggctgcgcgccgtcgcc
gaaaaaagtcagtgtggcgccgtactgggtatcggcggcggtaaaacgctggataccgcc
aaagcgctggcgcattttatgaacgtcccggtcgctatcgcgccgaccatcgcctctacc
gacgcaccgtgcagcgcgctctcggttatttatacggatgccggtgagtttgaccgttat
ctgctgctgccgcataacccgaatatggtcattgtcgatacgcagatagtggcgggcgcg
ccggcgcgtctgctggcagccggtatcggcgatgcactggcgacctggtttgaagcgcgc
gcctgctcacgcagcggcgccaccacaatggcgggcggcaagtgtacacaggccgcgctg
gcgctggcggagctatgctataacacgctgatcgaagaaggcgaaaaagccatgttggcc
gccgaacagcacgtcgtcacgccagcgctggagcgcgtcatcgaagccaacacctacctg
agcggggtcggttttgaaagcggcggtctggccgcagcgcacgcgattcataacggttta
acggcgattccggatgcgcaccactattatcacggtgagaaggtcgctttcggtacgctg
acgcaactggtgctggaaaacgcgccggtcgaagaaatcgaaaccgttgcggcgctgtgc
cattccgttggcctgccgattacgctggcgcaactggatattaaacaggatatcccggcc
aaaatgcgcaccgtcgcggaagcctcctgcgcagaaggtgaaactattcataacatgcct
ggcggcgcaacgccggatgaagtgtacgccgcgctgctggtcgccgaccagtatggtcaa
cgctttttgcaggaatgggaataa

DBGET integrated database retrieval system