KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4810Help
Entry
SeSA_A4810        CDS       T00743                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00230  Purine metabolism
sew00240  Pyrimidine metabolism
sew01100  Metabolic pathways
sew03030  DNA replication
sew03430  Mismatch repair
sew03440  Homologous recombination
Module
sew_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SeSA_A4810 (holD)
   00240 Pyrimidine metabolism
    SeSA_A4810 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SeSA_A4810 (holD)
   03430 Mismatch repair
    SeSA_A4810 (holD)
   03440 Homologous recombination
    SeSA_A4810 (holD)
Enzymes [BR:sew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SeSA_A4810 (holD)
DNA replication proteins [BR:sew03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SeSA_A4810 (holD)
DNA repair and recombination proteins [BR:sew03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SeSA_A4810 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C Inhibitor_I66
Motif
Other DBs
NCBI-ProteinID: ACF90688
UniProt: A0A0N1QWD4
Position
4668681..4669118
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLSLAPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacaaggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacccgcgctgaacgagccgctaatgcgcgatattttacgcgcg
ttgaccgtgagtcccgatcaggttttatccctggcgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system