KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_1040Help
Entry
STBHUCCB_1040     CDS       T01741                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Brite
KEGG Orthology (KO) [BR:sex00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    STBHUCCB_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AEZ43864
Position
complement(102087..102464)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGKGVVGVQPRIAPGEEYQYTGGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtgcaaagcgtctacattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtaaccatccgcaatctgggtcgg
gcgccagtgcagctattgggccgctactggctgattaccaatggtcatggccgtgaaact
gaagtccagggcaaaggtgtggttggcgtccagccgcgcattgcgcctggcgaagagtat
cagtacaccggcggcgcggtaattgaaacgccgctgggcaccatgcagggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacattcccgtgtttcgactcgccgtc
cctacactcattcactaa

DBGET integrated database retrieval system