KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_11810Help
Entry
STBHUCCB_11810    CDS       T01741                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00900  Terpenoid backbone biosynthesis
sex01100  Metabolic pathways
sex01110  Biosynthesis of secondary metabolites
sex01130  Biosynthesis of antibiotics
Module
sex_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STBHUCCB_11810
Enzymes [BR:sex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     STBHUCCB_11810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEZ44894
Position
complement(1181007..1181855)
Genome map
AA seq 282 aa AA seqDB search
MTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRHDGEIHLLTPVTGVE
NEDNLIVRAARLLMKVASESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNHL
WQCGLSIDELATLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVSIPT
PVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGTG
ACVFAEFDTESCARQVLEQAPEWLNAFVAKGVNLSPLHRELL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacccattggccttctccggcaaaattaaatctgtttttatatatcaccggacagcgt
gcagacggctaccacacgctgcagacgctgtttcagtttctggattatggcgacacactc
cacatcgaaccgcgtcacgatggcgaaatccatttattaacgccggtaaccggcgttgaa
aatgaagacaatctgatcgtccgcgccgcgcggctgttgatgaaagtcgcctcggagagt
ggacgcctgcccgccggaagcggcgcggatatcagcattgagaagcgccttcccatgggc
ggcggtctgggtggcggctcgtctaacgccgcgaccgttctggtggcgctcaatcatctt
tggcaatgcgggctttccattgatgaactggcgacgctcggcctgacgctcggcgccgac
gtcccggtctttgttcgtggccacgccgcgtttgccgaaggcgtaggcgaaatattaacg
ccggtgaatccgccggaaaaatggtatctggtcgcgcaccctggcgtaagcattccgacg
ccagttatctttaaagatcctcaattgccgcgtaatacgccaaaaaggtcaatagatacg
ttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgcgag
gttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggacaggg
gcctgtgtctttgctgaattcgatacagagtcttgtgctcgccaggtgcttgagcaagcc
ccggaatggctcaatgcttttgtggcgaagggtgttaacctttccccattgcatcgagag
ttactctaa

DBGET integrated database retrieval system