KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_19100Help
Entry
STBHUCCB_19100    CDS       T01741                                 

Definition
(GenBank) Delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00250  Alanine, aspartate and glutamate metabolism
sex00330  Arginine and proline metabolism
sex01100  Metabolic pathways
sex01110  Biosynthesis of secondary metabolites
sex01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sex00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STBHUCCB_19100
   00330 Arginine and proline metabolism
    STBHUCCB_19100
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sex03000]
    STBHUCCB_19100
Enzymes [BR:sex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     STBHUCCB_19100
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     STBHUCCB_19100
Transcription factors [BR:sex03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    STBHUCCB_19100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AEZ45599
Position
1856014..1859976
Genome map
AA seq 1320 aa AA seqDB search
MGTTTMGVKLDDATRERIKMAASRIDRTPHWLIKQAIFSYLDKLENSDTLPELPALFAGA
ANESEEPVAPQDEPHQPFLEFAEQILPQSVSRAAITAAWRRPETDAVSMLMEQARLSPPV
AEQAHKLAYQLAEKLRNQKSASGRAGMVQGLLQEFSLSSQEGVALMCLAEALLRIPDKAT
RDALIRDKISNGNWQSHIGRSPSLFVNAATWGLLFTGRLVSTHNEANLSRSLNRIIGKSG
EPLIRKGVDMAMRLMGEQFVTGETIAQALANARKLEEKGFRYSYDMLGEAALTAADAQAY
MVSYQQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYDRVMEELYPRLKSLTLLA
RQYDIGLNIDAEEADRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPLVIDYLVDL
ASRSRRRLMIRLVKGAYWDSEIKRAQMEGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLI
YPQFATHNAHTLAAIYHLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVGDGKLNRPCRIY
APVGTHETLLAYLVRRLLENGANTSFVNRIADATLPLDELVADPVEAVEKLAQQEGQAGI
PHPKIPLPRDLYGEGRINSAGLDLANEHRLASLSSALLSNAMQKWQAKPVLEQPVADGEM
TPVINPAEPKDIVGWGREATESEVEQALQNAVNPAPVWFATPPQERAAILQRAAVLMEDQ
MQQLIGLLVREAGKTFSNAIAEVREAVDFLHYYAGQVRDDFDNETHRPLGPVVCISPWNF
PLAIFTGQIAAALAAGNSVLAKPAEQTSLIAAQGIAILLEAGVPPGVVQLLPGRGETVGA
QLTADARVRGVMFTGSTEVATLLQRNIATRLDAQGRPIPLIAETGGMNAMIVDSSALTEQ
VVVDVLASAFDSAGQRCSALRVLCLQDDIAEHTLKMLRGAMAECRMGNPGRLTTDIGPVI
DSEAKANIERHIQTMRAKGRPVFQAARENSDDAQEWQTGTFVMPTLIELENFAELEKEVF
GPVLHVVRYNRNQLAELIEQINASGYGLTLGVHTRIDETIAQVTGSAHVGNLYVNRNMVG
AVVGVQPFGGEGLSGTGPKAGGPLYLYRLLAHRPPNALNTTLTRQDARYPVDAQLKTTLL
APLTALTQWAADRPALQTLCRQFADLAQAGTQRLLPGPTGERNTWTLLPRERVLCLADDE
QDALTQLAAVLAVGSQALWSDDAFHRDLAKRLPAAVAARVQFAKAETLMAQPFDAVIFHG
DSDKLRTVCEAVAAREGAIVSVQGFARGESNMLLERLYIERSLSVNTAAAGGNASLMTIG
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccaccacgatgggggttaagctggacgacgccacgcgcgaacggatcaaaatg
gccgcgtcgcgtatcgatcgcacgccgcactggttaataaaacaggcaatctttagctat
ctggacaagctggaaaatagcgatacgctaccggagctacctgcgctgtttgccggcgcg
gcaaatgaaagcgaggagccggtcgcgccgcaggatgagccgcatcagccctttctggag
tttgccgaacagattcttccccaatccgtctctcgcgccgccatcaccgccgcctggcgc
cgcccggaaaccgatgcggtgtcaatgctaatggaacaggcgcgcctgtcgccgcctgtc
gctgagcaggcgcataaactggcgtatcaactggcggagaaattgcgcaatcaaaaatcc
gccagcggtcgcgcgggtatggtgcaaggcctgttgcaggagttttccctctcttcgcaa
gaaggcgtagcgctgatgtgtctggcggaagcgctgctgcgtattcccgacaaagctacg
cgcgatgcgttaattcgcgacaaaatcagtaatggcaactggcagtcgcatattggccgt
agcccgtcgctgtttgtaaacgccgccacctgggggctgctctttaccggccgactggtc
tcaacgcataacgaagccaatctttcgcgctcgctgaaccgcattatcggcaagagcggc
gaaccgttaatccgcaaaggcgtcgacatggcgatgcgtttaatgggcgagcagttcgtg
actggcgaaaccattgctcaggcgctggcgaatgcccgaaaactggaagagaaagggttc
cgctattcttacgatatgctgggcgaagccgcgttaaccgccgccgatgcgcaggcctat
atggtctcttaccagcaagcgattcatgccatcggcaaagcgtctaacggtcgcggtatt
tacgaagggccaggcatctcgattaagctgtccgccctgcatccacgctatagtcgcgcg
caatacgatcgggtaatggaggagctttatccgcgcctgaaatccctgacgctgctggcg
cgccagtatgatatcggtctcaatatcgacgccgaagaggcggatcgtctggagatctcg
cttgatctgctggaaaaactctgcttcgaacccgaactggcgggctggaacggcattggc
tttgtgattcaggcttaccagaaacgctgcccgctggtcattgattatttagtcgatctg
gcctcccgtagccgccgtcggctgatgattcgtctggtgaaaggcgcctactgggatagc
gagatcaaacgcgcgcaaatggaagggctggagggctatccagtttatacccgcaaagtg
tataccgatgtctcttatctggcctgcgcgaaaaaactgctcgccgtccctaatctgatc
tacccgcagttcgcgacccataacgctcacacactggcggcgatttatcatctggccggg
caaaattactatccgggtcagtacgaattccagtgcctgcacggcatgggagaaccgctg
tatgaacaggtcaccggtaaagtgggggacggaaaacttaaccgtccctgccgtatttac
gcgccggtgggaacacacgaaaccctgctggcctatctggtacgacgcctgctggaaaac
ggcgccaacacctcttttgtcaaccgcatcgccgatgccaccctaccgctcgatgaactg
gtggccgacccggtcgaggccgtggaaaaactggcgcagcaggaaggtcaggctggcata
ccgcatccaaaaattccgctgccgcgcgatctgtacggcgaaggtcggataaactccgcc
ggacttgatttagcgaatgaacatcgcctcgcctcgctttcttctgccctgttaagcaac
gccatgcagaaatggcaggccaaacctgtgctggaacaaccggtggccgacggtgagatg
acgccggttatcaacccggcggaaccgaaagatattgttggctggggacgcgaagcgaca
gaaagcgaggttgaacaggcgttgcaaaacgcggtcaatccggcgccggtttggtttgcg
acgccgccgcaagaacgcgccgctattttgcagcgggcggcggtattgatggaagaccaa
atgcagcagttgattggcctgttggtgcgtgaagcggggaaaacgttcagcaacgccatt
gccgaagtgcgcgaagcggtagacttcctccattattatgccggtcaagtgcgtgacgat
ttcgataacgaaacgcatcgcccgttagggccggtggtctgtatcagtccgtggaacttt
ccgctggccattttcactggccaaatcgccgccgcgctggcggcaggtaacagcgttctg
gcgaaaccggcagagcagacatcgctgattgccgcccagggcattgccattttgctggaa
gcgggcgtaccgccgggcgtcgtgcaactgttgccgggacggggagaaaccgtcggcgcc
cagcttaccgccgatgcgcgtgtacgcggcgtgatgtttaccggttccacggaggtcgcg
acgttgttgcagcgcaacatcgccacgcgtcttgacgcccaggggcgccctattccgttg
attgcggaaaccggcggtatgaacgctatgattgtcgactcttccgcgctcaccgagcag
gtggtcgtggatgtgctggcttccgccttcgacagcgccggacaacgctgttccgcgctc
cgcgtgctgtgtttgcaggacgatatcgccgaacatacgctgaaaatgttacgcggcgcg
atggcggagtgtcggatggggaatccaggccgtctgacgaccgatatcgggccggtgatc
gatagcgaggccaaagccaacattgaacgtcatatccagacgatgcgcgccaaaggccgc
ccggttttccaggccgcgcgtgaaaacagcgatgacgcgcaggaatggcagaccggtacg
tttgttatgcccacgcttattgagctggaaaacttcgcagaactggaaaaagaggtcttc
gggcccgtgctgcacgtcgtgcgttataaccgtaaccaactggcggagcttatcgaacag
attaacgcttccggctacgggctaacgctgggcgtacatacccgtattgatgaaaccatt
gcgcaagtcaccggttccgcccatgtcggcaacctgtacgttaaccgtaatatggtgggc
gcggtcgtcggcgtccagccgtttggcggcgaaggcctgtccggcaccgggccaaaagcg
ggagggccgctctatctctaccgcctgctggcacaccgcccgcccaatgcgctcaatacg
acgctgactcgtcaggatgcgcgttacccggtggatgcgcagcttaaaaccacgctactc
gcgccgttgaccgctctgacgcaatgggcggcggatcgcccggcgctacagacgctctgc
cgacaattcgccgatctggcgcaggccggcacgcagcgcctgctaccggggccgaccggc
gagcgtaatacctggacgctgttgccgcgtgaacgggtgttatgcctggctgatgatgaa
caggacgcgttgacgcagcttgccgccgttctcgccgtcggcagtcaggcgctatggtca
gacgacgccttccaccgcgatctggcgaaacgtctccccgccgccgtcgcggcgcgtgtc
cagtttgcgaaagcggaaacgctgatggcgcagccgtttgacgcggtgattttccacggc
gactccgacaagctgcgaaccgtgtgcgaagccgtcgccgcccgcgaaggcgcgatagtg
tcggtacaggggttcgcccgcggcgaaagcaatatgctgctggaacggctctatattgaa
cgttcgctgagcgtaaacactgccgccgctggcggtaatgccagcctgatgacaattggc
taa

DBGET integrated database retrieval system