KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_27240Help
Entry
STBHUCCB_27240    CDS       T01741                                 

Definition
(GenBank) Rhs-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sex00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STBHUCCB_27240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sex02044]
    STBHUCCB_27240
Secretion system [BR:sex02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STBHUCCB_27240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD T3SSipB
Motif
Other DBs
NCBI-ProteinID: AEZ46385
Position
complement(2647188..2649377)
Genome map
AA seq 729 aa AA seqDB search
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAEAAVEQAAGSLFGALPEP
SGLVKAAVAAAQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGG
ETLSELFSYVVQLKTPDTLNLGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTA
ARVVGHEGRSVTYELRMEPWVKLLTHTSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVES
YPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVLADAISAHKACPDSPLVEW
HQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRETGHATYEHYEW
PGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQE
IWTDQYGRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGD
PDLPIIVGRTYNQDTMPPWGLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHA
EKDLNTTVKNNETHTVMVDRTKTIIKNETNSIGEDRNTTVTKNDGLSVKLAQTINIGTTY
RLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVMQLIGKGIDMNPDGGTAVTAD
DIAPLPTSE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgtatccacaaataataaatccggtatgggagggctgacgacaaccacgccg
ccgataaccggagaaagtggcggtgtcaccgcagattcagtcgccggaagcgtggcagat
gcggcagaagccgccgtggaacaggctgcgggatcgctgtttggcgcattgccggagcca
tcaggactggtgaaagccgcggtggcagcggcgcaggctgccgccgctgcaggtatggcg
caggatgcggtatcggccatcgtctctgctgttgcaggcgggccgggggcgcataatgtg
acggtcagcggcagcgccgtaccgccgggcgcattactgttcgccagcctggacggcggc
gaaacattaagtgaactgttcagttatgtggtacagctaaaaacgcccgacaccctgaat
ctgggctatgtctccccggcggccaacctgccgctcaaaccgatggtgggcaaagatctg
tgcgtcaacatcgaactggatggtggcggtaaacgacatatcagcgggctggtcacggcg
gcgcgggtggtgggccatgaagggcgttcggttacctatgagctgcgtatggagccgtgg
gtaaaactgctgacccataccagcgactacaaagcattccagaataaaaccgtggtggat
attctggatgaggttctggcggaatacccctacccggtggaaaagcggctggtggaaagc
tacccggtacgcacctggcaggtgcagtacggtgaaactgattttgattttcttcagcga
ctgatgcaggagtggggcatctactggtggtttgagcacagcgaggacagccacacgctg
gtgctggcggatgccatcagcgcccacaaagcatgtccggactcgccgctggtcgagtgg
caccaggaagggctgaagctggacaaggagtttatccacactatcacggcaaacgagagt
ctgcggactggccagtgggtgctggatgatttcgattttacgaagccacgttcattgctg
gcaaacaccgtggcaaacccgcgtgaaaccggtcatgccacctacgagcattatgagtgg
ccgggagactacttcgacaagagtgaaggcgagatgctgacgcgcattcgtatggaagcg
cagcgcagccccggcagtcgggtgctggggggagggaatatccgcacactcatgaccggt
tataccttcacgctggaaaactatcccaccgccgaagtcaatcaggaatacctgctgatg
cagaccttgctgtttgtacaggacaacgcgcagcacagcgggcaggaccagcactttacc
ttttccacccgttttgaactgcacccgacccgtgaggtgttccgcccgcagcggacggtg
agcaaaccccacaccaaagggccgcagagcgccatcgtcaccggcccggcgggccaggaa
atctggacggatcagtacgggcgggtaaaggtacagtttggctgggatcgctacggcaaa
atggatgaaaacagctcctgctggatacgcgtcagctacccatgggcgggcaaaggcttc
gggatgatccagatcccgcgtatcggccaggaagtgctggtggatttcaaaaacggcgat
ccggatctgccgatcatcgtggggcgtacctacaaccaggacaccatgccgccgtgggga
ctgccgggaatggcgtcgcagagcgggatcttcagccactcgctgtatggcgggccaacg
aacggcaacatgctgcgttttgacgacaaaacgggcgcggaggaagtgaagttccacgcg
gaaaaagatctcaacaccacggtgaagaataatgaaacgcatacggttatggtggatcgc
actaaaaccattattaaaaatgaaaccaacagtattggtgaagacagaaacaccacggta
acgaagaatgacggcctttccgtaaaactggcgcagacgatcaatatcggcaccacttat
cgtttagatgttggcgatcaattcacacttcgctgcggcaatgcggcgcttgttttacat
aaggacggctccattgagttttgtggcaagcaactgatgttgcataccagcgatgtcatg
caactgattggtaaaggtattgatatgaacccggatggcggcacagccgtaaccgccgat
gatattgccccccttcccacctctgagtga

DBGET integrated database retrieval system