KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_27390Help
Entry
STBHUCCB_27390    CDS       T01741                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sex00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STBHUCCB_27390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sex02044]
    STBHUCCB_27390
Secretion system [BR:sex02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STBHUCCB_27390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AEZ46398
Structure
PDB: 

Position
complement(2662247..2662732)
Genome map
AA seq 161 aa AA seqDB search
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDH
YIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIA
SRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgacatttttttaaaaattgacggcattgatggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatattcatcaggaatccaccatg
cacgccggtagcggcctcggctccggtaaggtctccgtcactaatctggattttgatcac
tatatcgatcgcgccagcccgaacctgttcaaatactgcgcctccggcaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtatacc
ttcaccgacctgattgtcgccgtggtttccccgagcggcagccacgatggtgaaatcgcc
tcccgtgaaacggtcgagctttctttcagcactgtgaaacaggaatacgtggtgcagaac
cagcagggcggcagcggcggcactatcaccgcaggttacgacttcaaggcgaacaaagaa
atttaa

DBGET integrated database retrieval system