KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_27430
Entry
STBHUCCB_27430    CDS       T01741                                 

Definition
(GenBank) Type VI secretion protein
  KO
K11901  type VI secretion system protein ImpB
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Brite
KEGG Orthology (KO) [BR:sex00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sex02044]
    STBHUCCB_27430
Secretion system [BR:sex02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STBHUCCB_27430
SSDB
Motif
Pfam: T6SS_VipA DUF6103
Other DBs
NCBI-ProteinID: AEZ46400
Position
complement(2665352..2665894)
AA seq 180 aa
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDR
KFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALN
QLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLANAPKSAATQQGVSADNESAE
NT seq 543 nt   +upstreamnt  +downstreamnt
atggctatcaacaatagcgcgcagaaattcatcgcgcgcaaccgcgcgccgcgcgtgcag
attgaatatgacgtagagatttacggttccgagaaaaaaatcgagctgccgttcgtgatg
gcggtgctggccgatctggccgggaaaccgcgtgaagaactgccgccggtgacggatcgc
aaattcctcgatattgatattgataacttcaatgagcgcatgaaagccattgcgccgcgc
gtggcgttcgctgtgccgaatacgctgacgggtgaaggtcagttgatggtcgatatcacc
ctggaaaatatggacgacttttcgccggcacagattgcccgcaaggtggacgccctgaac
cagttactggaagcccgcactcaactggcgaacctccagacctacatggatggcaaggcc
ggggcggaaaatctggtcaataaactgttgcaggacccgactctgctgaaaacgctggcg
aatgcgccgaaatcggccgctacccagcaaggtgtgtcagcggataatgaatcagcggaa
taa

DBGET integrated database retrieval system