KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_36710Help
Entry
STBHUCCB_36710    CDS       T01741                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00471  D-Glutamine and D-glutamate metabolism
sex01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sex00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    STBHUCCB_36710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sex01011]
    STBHUCCB_36710
Enzymes [BR:sex01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     STBHUCCB_36710
Peptidoglycan biosynthesis and degradation proteins [BR:sex01011]
 Precursor biosynthesis
  Racemase
   STBHUCCB_36710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AEZ47288
Position
complement(3574908..3575690)
Genome map
AA seq 260 aa AA seqDB search
MLVFDSGVGGLSVYDEIRRLLPDLHYIYAFDNVAFPYGEKSETFIVERVVEIVTAVQQRY
PLSLAVIACNTASTVSLPALREKFAFPVVGVVPAIKPAARLTANGVVGLLATRATVKRPY
THELIARFANECQIAMLGSAELVELAEAKLHGDSVSLEELRRILRPWLRMPEPPDTVVLG
CTHFPLLRDELLQVLPEGTRLVDSGAAIARRTAWLLEHEAPDAKSTDANIAYCMAMTPGA
EQLLPVLQRYGFETLEKLAV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtatttgattccggcgtcggtggattgtcggtctatgatgagattcggcggctc
ctgccggatctccactatatatatgctttcgataacgtggctttcccctacggggaaaag
agcgaaacgtttatcgttgagcgcgttgtcgagattgtgactgcggtacagcagcgctat
cccctttcactggcggtgattgcctgtaataccgccagtacggtctcacttcccgcatta
cgtgaaaagtttgccttcccggtggtgggcgttgtgcctgcgattaaaccagcggcgcgg
cttaccgccaatggcgtcgtcgggctactggcgacgagagccacggtcaaacgtccttat
actcacgagctgattgcgcgcttcgccaatgaatgtcagatagcgatgttggggtcggca
gaactggtggaactggcggaagctaaattacatggcgattcggtatcgctggaagaactg
cgccgtatattacgcccatggctacgaatgccggagccgcctgacacggtcgttctgggg
tgtacgcatttccctctattacgggacgagcttttgcaagtcctgcccgaagggacgcgg
ttagtggattccggcgcggcgatagcgcgtcgtacagcctggctgttggaacatgaagcg
ccggatgcgaaatcaaccgatgccaatattgcttattgcatggcaatgacgccaggagct
gaacaattattacccgttttacagcgttatggctttgaaacgctcgaaaaactggcggtt
taa

DBGET integrated database retrieval system