KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_37400Help
Entry
STBHUCCB_37400    CDS       T01741                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00010  Glycolysis / Gluconeogenesis
sex00030  Pentose phosphate pathway
sex00051  Fructose and mannose metabolism
sex00052  Galactose metabolism
sex00680  Methane metabolism
sex01100  Metabolic pathways
sex01110  Biosynthesis of secondary metabolites
sex01120  Microbial metabolism in diverse environments
sex01130  Biosynthesis of antibiotics
sex01200  Carbon metabolism
sex01230  Biosynthesis of amino acids
sex03018  RNA degradation
Module
sex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STBHUCCB_37400
   00030 Pentose phosphate pathway
    STBHUCCB_37400
   00051 Fructose and mannose metabolism
    STBHUCCB_37400
   00052 Galactose metabolism
    STBHUCCB_37400
  Energy metabolism
   00680 Methane metabolism
    STBHUCCB_37400
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    STBHUCCB_37400
Enzymes [BR:sex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STBHUCCB_37400
Protein phosphatases and associated proteins [BR:sex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STBHUCCB_37400
Messenger RNA biogenesis [BR:sex03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     STBHUCCB_37400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEZ47351
Position
complement(3646604..3647566)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGHGGRCVGIQNEQLVHHDIIDA
IENMKRPFKSDWMECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
atccgcggtgttgtgcgcgcagcgttgacggaagggctggaagtcatgggcatttatgac
ggctatctgggcctgtatgaagatcgtatggttcagcttgaccgttacagcgtatctgac
atgatcaaccgtggcggtactttcctcggttccgcccgtttcccggaattccgtgacgaa
aatattcgcgctgtcgcgatcgaaaacctgaaaaaacgcggtatcgatgcgctggtagtt
attggcggcgacggttcttatatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcggtctgccaggcactatcgataacgacatcaaaggcaccgactacactatcggctac
ttcactgctctcggcactgtagtggaagcgattgaccgtctgcgtgacacctcctcttct
caccagcgtatctctatcgttgaggtgatgggccgttattgcggcgacctgacgttggcg
gcggctattgctggcggctgtgagtttatcgtggtgccggaagttgaatttaatcgcgaa
gatctggtggccgaaatcaaagccgggatcgcgaaagggaaaaaacacgctatcgtcgct
attactgagcatatgtgcgatgttgacgaactggcgcactttattgaaaaagaaacgggc
cgtgaaacgcgtgcgacggtgctcggccacattcagcgcggtggttccccggtaccttac
gatcgcattctggcttcccgtatgggcgcgtatgctattgacctgctgctggaaggccat
ggcggtcgttgtgtcggtatccagaacgagcagcttgttcatcatgacatcatcgatgcg
attgaaaacatgaagcgtccgttcaaaagcgactggatggagtgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system