KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_46690Help
Entry
STBHUCCB_46690    CDS       T01741                                 

Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00230  Purine metabolism
sex00250  Alanine, aspartate and glutamate metabolism
sex01100  Metabolic pathways
Module
sex_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sex00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STBHUCCB_46690
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STBHUCCB_46690
Enzymes [BR:sex01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     STBHUCCB_46690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AEZ48232
Position
4556428..4557726
Genome map
AA seq 432 aa AA seqDB search
MGNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVTSIIGNGVVLSPSALMKEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAE
AVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYGA
TTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTP
LAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDR
TETMILRDPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaacgtcgtcgtactgggcacccaatggggtgacgaaggtaaaggaaagatc
gtcgatcttctgactgaacgggctaaatatgttgtacgctaccagggcggtcacaacgca
ggccatactctcgtaatcaacggtgaaaaaaccgttctccatcttattccatcaggtatt
cttcgcgagaatgtaaccagcatcatcggtaacggtgttgtgctgtctccgagcgcgctg
atgaaagagatgaaagaactggaagaccgtggcatccccgttcgtgagcgtctgctgctg
tctgaagcctgtccgctgatccttgattatcacgttgcgctggataacgcgcgtgagaaa
gcgcgtggcgcgaaagcgatcggcaccaccggtcgtggaatcgggcctgcttatgaagat
aaagtggcacgtcgcggtctgcgtgttggtgaccttttcgacaaagaaacctttgctgaa
aaactgaaagaagtgatggaatatcacaacttccagttggttaactactacaaagctgaa
gcggttgattaccagaaagttctggatgatacgatggctgttgccgacatcctgacttct
atggttgttgacgtttcagacctgctcgaccaggcgcgtcagcgtggcgatttcgtcatg
tttgaaggtgcgcagggtaccctgctggatatcgaccacggtacttatccgtacgtaact
tcttctaacaccactgcgggtggcgtggcgaccggttccggcctgggcccgcgttatgtt
gattacgttctgggtatcctcaaagcttactccactcgtgtaggtgcaggtccgttcccg
accgaactgtttgatgaaaccggcgagttcctctgcaagcagggtaacgaatacggcgcc
actaccggccgtcgtcgtcgtaccggctggctggacaccgttgccgttcgtcgtgcggta
cagctgaactccctgtctggcttctgcctgaccaaactggacgtgctggatggcctgaaa
gaggtgaaactctgcgtggcttaccgtatgccggatggtcgcgaagtgactaccactccg
ctggcagctgacgactggaaaggtgtagagccgatttacgaaaccatgccgggctggtct
gaatccaccttcggcgtgaaagatcgtagcggcctgccgcaggcggcgctgaactacatc
aaacgtatcgaagaactgaccggcgtgccgattgatattatttctaccggccccgatcgt
actgagacgatgattctgcgcgatccgttcgacgcgtaa

DBGET integrated database retrieval system