KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_5460Help
Entry
STBHUCCB_5460     CDS       T01741                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00130  Ubiquinone and other terpenoid-quinone biosynthesis
sex00627  Aminobenzoate degradation
sex01100  Metabolic pathways
sex01110  Biosynthesis of secondary metabolites
sex01120  Microbial metabolism in diverse environments
sex01220  Degradation of aromatic compounds
Module
sex_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:sex00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    STBHUCCB_5460
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    STBHUCCB_5460
Enzymes [BR:sex01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     STBHUCCB_5460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AEZ44286
Position
582495..583064
Genome map
AA seq 189 aa AA seqDB search
MKRLIVGISGASGAIYGVRLLQILRDVDSVETHLVMSQAARQTLALETHFSLREVQALAD
VTHDARDIAASISSGSYPTAGMVILPCSIKTLSGIVHSYTDGLLTRAADVILKERRPLVL
CVRETPLHIGHLRLMTQAAEIGAVIMPPVPAFYHLPQTLDDVINQTVNRVLDQFDIPLPH
DLFVRWQGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactcattgtaggtattagcggcgccagcggagcgatttatggcgtgcgctta
ttacaaattttgcgcgatgtcgatagcgtggaaacgcatctggtgatgagccaggcggcc
cggcaaacgctggcgctggagacccatttttcgctgcgcgaggtgcaggcgctggccgat
gtgacgcacgatgcgcgcgacattgccgccagcatttcctccggctcttacccgacggca
ggaatggttatcctgccctgttcgattaaaacgctgtcggggattgtccacagttatact
gacggactgcttacccgcgcggcggatgtgatattaaaagagcggcgacctctggtgctg
tgtgtgcgcgaaacgccgctgcatatcgggcatttgcgtttaatgacccaggccgctgag
ataggcgcggtgattatgccgccggttccggctttttatcaccttcctcagacgttagat
gatgttataaatcaaacggttaaccgagtgttggatcaatttgacatcccccttccgcac
gacctttttgttcgctggcagggcgcatag

DBGET integrated database retrieval system