KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_6050Help
Entry
STBHUCCB_6050     CDS       T01741                                 

Definition
(GenBank) UDP-glucuronic acid oxidase, UDP-4-keto-hexauronic acid decarboxylating
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00520  Amino sugar and nucleotide sugar metabolism
sex01100  Metabolic pathways
sex01503  Cationic antimicrobial peptide (CAMP) resistance
Module
sex_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:sex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STBHUCCB_6050
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    STBHUCCB_6050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:sex01005]
    STBHUCCB_6050
Enzymes [BR:sex01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     STBHUCCB_6050
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     STBHUCCB_6050
Lipopolysaccharide biosynthesis proteins [BR:sex01005]
 Unusual sugar
  STBHUCCB_6050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_4 NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AEZ44345
Position
complement(639000..640982)
Genome map
AA seq 660 aa AA seqDB search
MKAVIFAYHDMGCQGVQAVLDAGYEIAAIFTHADNPAENTFFGSVSRLAAGLGIPVYAPD
NVNHPIWVDRIAELAPDIIFSFYYRNLLSEEILHLAPAGAFNLHGSLLPAYRGRAPLNWV
LVNGESETGVTLHRMVKRADAGEIVASQRVAIAQDDVALTLHHKLCQAARQLLNSILPTM
KCGNIPSVPQRESDATYYGRRRPEDGLIDWHKPVSTVHNLVRAVAAPWPGAFSYNGSQKF
TIWSSRICPDAQGALPGSVISVSPLRVACADGALEIITGQAGDGITVQGSQLAQTLGLVA
GACLNRPPATSGKRRIRVLILGVNGFIGNHLTERLLDEENYEVYGMDIGSNAISRFLLHP
RFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYC
VKYRKRVVFPSTSEVYGMCTDASFDEDKSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEK
EGLRFTLFRPFNWMGPRLDSLNAARIGSSRAITQLILNLVEGTPIKLIDGGQQKRCFTDI
RDGIEALFRIIVNEGDRCDGKIINIGNPDNEASIQELATLLLDSFDKHPLRCHFPPFAGF
QVVESRSYYGKGYQDVAHRKPSIDNARRCLDWEPSIAMRDTVEETLDFFLRSVDIAERAS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttatttttgcctatcacgatatgggatgtcagggcgtgcaggccgtactg
gatgcaggatatgagattgccgcaattttcactcatgccgacaatcctgcggaaaacacc
ttttttggctccgtctcccggctggcggcaggattagggattccggtttatgcgccggat
aacgtaaaccatcctatctgggtcgaccgcatcgctgaacttgcgccagatattattttt
tcgttctattaccgcaacctgttaagcgaagaaattctgcacctcgccccggctggcgcg
ttcaatctgcacggttctctattgccagcctatcgtggccgtgcgccgctaaactgggtt
ctggttaacggcgaaagcgaaacgggcgtaacgctgcatcgtatggtcaaacgtgccgac
gccggagagattgtcgccagtcaacgcgtcgctattgcgcaggacgatgttgcgcttacc
ctgcatcataagctatgtcaggccgcgcgccagttacttaatagcatcctgcccaccatg
aaatgcggcaatataccttctgttcctcagcgtgagtctgacgctacgtattatggtcgc
cgcaggccggaagatggccttatcgactggcacaaaccggtttccacggtgcataacctg
gtgcgggcggtagccgccccctggcccggcgcgttcagctataacggctcgcaaaaattc
actatctggtcttcccgaatttgtccggatgcgcaaggcgcgcttcccggctcggtaatt
tcggtctctccgctgcgggtcgcctgcgccgatggcgcgctggagattattaccggccag
gccggagacggcattactgtacagggctcgcagcttgcacagacgcttggtctggtggcg
ggcgcgtgtttgaaccgtccaccagcgaccagcggtaaacgtcgcattcgcgttctcatc
ctcggcgtcaacggttttatcggcaatcatttgaccgaacggttactggatgaagagaat
tacgaggtctacggtatggatatcggcagcaacgccattagccgattcctgctccaccct
cgctttcatttcgtggagggagatatcagcatccactcagaatggatcgaatatcatgtc
aaaaaatgcgatgtcgtactgccgctggtagcaattgcaaccccgattgaatacacccgc
aacccgctgcgcgtctttgaacttgattttgaagaaaacctgcggattatccgttattgc
gtgaaataccgtaaacgcgtggttttcccgtctacctctgaagtgtacggcatgtgtacg
gacgcctcttttgacgaagacaaatcgaatctgatcgtcgggccggtgaataagccgcgc
tggatttactccgtttccaaacagcttctcgaccgggtgatttgggcttatggcgaaaaa
gagggattgcgcttcacgcttttccgtccctttaactggatggggccgcggctggatagc
ctgaacgcggcgcgtatcggcagttcacgcgcgataacgcagttgattctgaacctggta
gaagggacgccgatcaagcttatcgacggcggtcagcagaagcgctgtttcaccgatatt
cgtgacgggatcgaagcattattccgcattattgtgaatgagggcgatcggtgcgatggc
aaaatcattaatatcggcaaccctgacaacgaagccagtattcaggaactggcgacgctg
ttgctcgacagttttgataagcatccgctgcgctgccatttcccaccatttgccggtttc
caggtcgtcgaaagccgtagttattacggcaagggttatcaggatgtcgcacaccggaaa
cccagtatcgacaatgccaggcgctgtctggactgggagccgtctattgcgatgcgtgat
acggttgaagaaacgctggacttctttctgcgtagcgtcgatatcgcggaacgcgcatca
tga

DBGET integrated database retrieval system