KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_0260
Entry
SL1344_0260       CDS       T01724                                 

Gene name
sciA
Definition
(GenBank) conserved hypothetical protein (SPI-6 associated)
  KO
K11902  type VI secretion system protein ImpA
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Brite
KEGG Orthology (KO) [BR:sey00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sey02044]
    SL1344_0260 (sciA)
Secretion system [BR:sey02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SL1344_0260 (sciA)
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: CBW16362
UniProt: A0A0H3N9G6
Position
complement(304656..305711)
AA seq 351 aa
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDAR
RLLTRSKDIRVLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAES
IEDASLARSNALAALLDHEGVMADIRGITLSNSAALRLQVRDVERALSAPRPADALAPES
VRQQLADLEARGALPLAAFREAQESAERLQVWARETLGDLAPDFSRLRQLLALLPDVVQT
TTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISLPHNAEPGPIRDRNDALER
LRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggacatgtccctgactaaaccggtaagcgcggaacaaccctgcggccccgatccggag
tacgatccggaatacctgctgctgttcagccgcgccgccccccaggcggaggcgcaatat
ggtgattttgtcagtacgccggaagccgtgaactggccggaaattgaacgtgatgcgcgc
cgtctgctcacgcgcagtaaggatatccgggtgttgatcctgctgctgcgcagtcgcatc
cagcaggctggcgcacagggactggcggaaatgctcacacaactggcagaactgagcgta
atctggtctgatgcactccatccacagctgcttaccggcgaaggcgcatccgcagaatct
attgaagatgcgtcgctggcgcgcagtaatgccctggcggcgctgctggatcacgaaggc
gtgatggcggacattcgcggtattacgctgtcaaacagtgccgccctgcgcctacaggta
cgggatgtggagcgcgcgttatccgctccccgcccggctgatgcgctggcccccgaatcc
gtccgccagcaactggccgacctcgaagcccgtggggcattaccgctggcggcgtttcgc
gaagcgcaggaaagcgcagaacgcctgcaagtgtgggcgcgtgagacattaggcgatctg
gctccagatttttcacgcctgcggcagttgttagcgctgctgcctgacgtggtacagaca
accacaccggaaatccctccgtcgccagcgccagtgccagaccccgcaggcacggttatg
gataatgccgttccggcacgggcagaggatgtgccgcctgtcaacgcgccacccggtata
tccctcccacacaatgctgaaccggggccaattcgcgatcgtaatgatgcgctggaacgc
ctgcggtgcattcgtcgctggtttgagagcagtgaacccagtagcccgaccatcccactg
ttacgccaggctgaaagactggtgggaaaacggttctcggaggtgatcaatgagatcccg
gtggagttgctggagaagtgggatgccctggagtga

DBGET integrated database retrieval system