KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_0267
Entry
SL1344_0267       CDS       T01724                                 

Gene name
sciH
Definition
(GenBank) conserved hypothetical protein (SPI-6 associated)
  KO
K11901  type VI secretion system protein ImpB
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Brite
KEGG Orthology (KO) [BR:sey00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sey02044]
    SL1344_0267 (sciH)
Secretion system [BR:sey02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SL1344_0267 (sciH)
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CBW16369
UniProt: A0A0H3ND31
Position
313924..314466
AA seq 180 aa
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDR
KFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALN
QLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLANAPKSAATQQDVSADNESAE
NT seq 543 nt   +upstreamnt  +downstreamnt
atggctatcaacaatagcgcgcagaaattcatcgcgcgcaaccgcgcgccgcgcgtgcag
attgaatatgacgtagagatttacggttccgagaaaaaaatcgagctgccgttcgtgatg
gcggtgctggccgatctggccgggaaaccgcgtgaagaactgccgccggtgacggatcgc
aaattcctcgatattgatattgataacttcaatgagcgcatgaaagccattgcgccgcgc
gtggcgttcgctgtgccgaatacgctgacgggtgaaggtcagttgatggtcgatatcacg
ctggaaaatatggacgacttttcgccggcacagattgcccgcaaggtggacgccctgaac
cagttactggaagcccgcactcaactggcgaacctccagacctacatggatggcaaggcg
ggggcggaaaatctggtcaataaactgttgcaggacccgactctgctgaaaacgctggcg
aatgcgccgaaatcggccgctacccagcaagatgtgtcagcggataatgaatcagcggaa
taa

DBGET integrated database retrieval system