KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_0268Help
Entry
SL1344_0268       CDS       T01724                                 

Gene name
sciI
Definition
(GenBank) conserved hypothetical protein (SPI-6 associated)
  KO
K11900  type VI secretion system protein ImpC
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Brite
KEGG Orthology (KO) [BR:sey00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sey02044]
    SL1344_0268 (sciI)
Secretion system [BR:sey02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SL1344_0268 (sciI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: CBW16370
UniProt: A0A0H3N8D7
Position
314490..315983
Genome map
AA seq 497 aa AA seqDB search
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLANTITVSDDAY
KSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKD
ELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAK
VAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVTQNLEYAPWNSLRASEDSRYIGLT
MPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAAYAMGVNINRSFKHYGWCTLI
RGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPLIHRKNSDYAA
FIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKEREDMQR
WLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLT
GSLRLVTKLPSVKQGNA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacagtaatatgcaggcaaccgacgcggttgctcaggataccgcctccgcatcc
ggtgaatttgatgcgttgctgaatcaggccttccgacccaagactacccaggcggcaaaa
gccgtggaagccgcggtgcagacgctggcgaacacgatcaccgtcagcgatgacgcctat
aaaagcatcagcgctattattgcgcagatcgactttaaactgaccgaacagatcaaactg
atcctgcaacatcccgactggcagaagctggaatcctcgtggcgcggtatggagcatctg
gtttacaacaccgagaccgacgaaaagctgaaaattcgcttcatgaatctgtcaaaagat
gaattgcggcgcaacatgaagcgttacaagggcatcgcctgggatcaaagcccgatgttc
aagaaactgtatgaagccgaatacggccagttaggtggcgaaccttatggctgtatcatt
gcggattactacttcgaccatacaccgcccgatgtggatctgcttggctctatcgccaaa
gtcgccgcgtcggcccatgcgccgtttattgccggggcttccccctcggtactgcaaatg
gactcctggcaggaactggcgaatccccgcgacctgaccaaaatcgtcacccagaacctg
gaatatgcgccgtggaactcgctgcgggctagcgaagactcccgttatattggcctgacg
atgccgcgttttcttgcccgcctgccgtatggcgcaaaaaccaacccggtggacgagttt
gattttgaagaagatgcggatggttctgaccataccaaatacgtctggagcaacgcggcc
tacgcgatgggcgtaaacatcaaccgttccttcaaacactacggctggtgtacgttgatt
cgcggtgtggaatcaggcggtgcggtggaaaatcttccctgccataccttcccgactgac
gatggcggcgtggacatgaaatgcccgaccgaaatcgccatctctgaccgccgcgaggct
gaactggcgaaaaacggttttatcccgttgatccaccgtaaaaactcagactatgccgcc
tttatcggcgcacagtcgctgcaaaaaccacaggaatactacgatccggacgcgacggcc
aacgctaacctgtctgcccgtctaccgtacctgttcgcctgctcgcgcttcgctcacttc
ctcaaatgtatcgtccgcgacaaaatcggttcctttaaagagcgtgaggatatgcagcgc
tggctaaatgaatggattatgaattatgtcgacgccgatccggtgaactcctcgcaagaa
actaaagcccgtcgtccgctggctgccgctgaagtagtggtggaagaggtcgaaggcaat
ccaggttattacgacgcgaaattcttcctgcgtccgcatttccagcttgaagggctgacg
ggatcgctgcgcctggtgacaaaactgccgtcagtgaagcagggcaatgcctga

DBGET integrated database retrieval system