KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_1224Help
Entry
SL1344_1224       CDS       T01724                                 

Gene name
yeaD
Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00010  Glycolysis / Gluconeogenesis
sey01100  Metabolic pathways
sey01110  Biosynthesis of secondary metabolites
sey01120  Microbial metabolism in diverse environments
sey01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL1344_1224 (yeaD)
Enzymes [BR:sey01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SL1344_1224 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CBW17319
UniProt: A0A0H3NAW7
Structure
PDB: 

Position
complement(1324327..1325211)
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVIEQLTPVLSRRQLDDLDLIVVDHPQVKASFALQGAHLLSWKPVGEEEVLW
LSNNTPFKTGVALRGGVPICWPWFGPAAQQGLPSHGFARNLPWALKAHNEDDNGVMLTFE
LQSSEATRKYWPHDFTLLARFKVGKTCEIELEAHGEFATTSALHSYFNVGDIANVKVSGL
GDRFIDKVNDAKEGVLTDGIQTFPDRTDRVYLNPEACSVIHDATLNRTIDVVHHHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETVYATAPQQATEEKPSRLAQTICVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaatttttgccctcccggttatcgaacagcttacccctgtcctttcccgt
cgtcagcttgatgacctggatctgatcgtcgttgaccatccgcaggttaaagcctctttt
gcattacagggcgcgcaccttctctcctggaaacccgttggcgaggaagaggtattgtgg
ctcagtaataatacgcctttcaaaaccggcgtggcgctacgcggcggtgtaccgatctgc
tggccctggtttggacctgcggctcaacagggtctgccgtcacacggctttgcgcgtaat
cttccgtgggcgctaaaagcgcataatgaagatgataatggcgtaatgctgacatttgag
ctgcaaagcagtgaggccacccggaaatactggccgcacgatttcacgctgctggcacgt
tttaaagtgggtaaaacctgtgaaattgaactggaagcgcatggcgaatttgcaaccaca
tccgcgctccacagctattttaacgttggcgacatcgccaacgttaaggtcagcggactc
ggcgatcggtttattgataaagttaacgacgctaaagaaggtgtcctgaccgacggtata
caaacctttccggaccgtaccgatcgcgtttacctcaatcctgaagcatgtagcgtgatc
cacgatgcgacattaaaccgcacgattgatgtggtccaccaccatcaccttaacgtcgta
ggctggaaccctggcccggcgttgtccgtcagcatgggcgacatgccggatgacggctat
aaaacgtttgtctgcgttgaaacggtttacgctactgcgccgcaacaagccacagaagaa
aaaccctctcgtctggcgcagactatctgcgtcgctaaacgctaa

DBGET integrated database retrieval system