KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_2371Help
Entry
SL1344_2371       CDS       T01724                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00010  Glycolysis / Gluconeogenesis
sey00052  Galactose metabolism
sey00500  Starch and sucrose metabolism
sey00520  Amino sugar and nucleotide sugar metabolism
sey00521  Streptomycin biosynthesis
sey01100  Metabolic pathways
sey01110  Biosynthesis of secondary metabolites
sey01120  Microbial metabolism in diverse environments
sey01130  Biosynthesis of antibiotics
sey01200  Carbon metabolism
Module
sey_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sey_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL1344_2371 (glk)
   00052 Galactose metabolism
    SL1344_2371 (glk)
   00500 Starch and sucrose metabolism
    SL1344_2371 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SL1344_2371 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SL1344_2371 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SL1344_2371 (glk)
Enzymes [BR:sey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SL1344_2371 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CBW18473
UniProt: A0A0H3NDY0
Position
complement(2515680..2516645)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADSCIDCRRALSLFCVI
MGRFGGDLALTMGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattatcccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatagcgtcagcgtggaagatggttgt
atcgccatagcctgcccgattaccggtgactgggtagcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagccatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtatggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggaaaatctgcgcccgaaagatattaccgaa
cgcgccctggcggatagctgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatttggcggcgtttatatc
gctggcggtattgtcccgcgcttcctggaattttttaaagcgtccggcttccgtggtggc
tttgaagataaaggccgctttaaagattatgtacacggtattccggtctatctgattgtc
catgataatcctggcttgttaggttccggcgcgcatctgcgccagacattaggtcatatt
ctataa

DBGET integrated database retrieval system