KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_2905Help
Entry
SL1344_2905       CDS       T01724                                 

Gene name
pcm
Definition
(GenBank) Protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Brite
Enzymes [BR:sey01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SL1344_2905 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_32 NodS CMAS GCD14 DREV
Motif
Other DBs
NCBI-ProteinID: CBW19004
UniProt: A0A0H3NFC8
Position
complement(3090419..3091045)
Genome map
AA seq 208 aa AA seqDB search
MVSGRVQALLEQLRAQGIRDEQVLNALAAVPREKFIDEAFEHKAWENIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVHHVCSVERIKGLQWQARRRLKQL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMAQLDEGGILVLPVGDEQQFLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtggacgtgtacaggctcttcttgaacaattgcgcgcgcagggcatcagagat
gagcaggtgcttaatgcgcttgctgcagtgccgcgcgagaaatttattgatgaagcgttt
gaacataaggcctgggaaaatatcgctttgccgataggccagggtcagacgatttcgcag
ccctatatggtggcgcgaatgacggagctgctcgaactgacgccgcaatccagggtgctg
gaaattggtaccggttccggctatcagacggcgattctggcgcatctggtacatcacgtt
tgctccgttgagcggattaaggggctgcaatggcaggcgcgtcgccgcctgaagcagctc
gatttacataatgtttctacccgtcatggcgatggctggcaaggctggcaggcgcgtgcg
ccatttgacgctatcattgtgacggccgcgccgccggaaattcctaccgcgctcatggca
cagttggatgaaggcggcattcttgttctgcccgtgggcgatgagcagcagtttttgaaa
cgcgtgcgtcgccggggcggcgaatttattatcgataccgtggaggccgttcgcttcgtc
ccgttagtcaagggagagctggcctag

DBGET integrated database retrieval system