KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_3105
Entry
SL1344_3105       CDS       T01724                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sey00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SL1344_3105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sey02044]
    SL1344_3105
Secretion system [BR:sey02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SL1344_3105
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CBW19204
UniProt: A0A0H3NHV0
Position
complement(3311675..3312160)
AA seq 161 aa
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTK
FVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKP
VETMSLNFTKIEWQITAEKSDGAQQESRTSVWDLAMNQIGK
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgcgatttttttaaagctcgacaatatcaaaggcgaaagccaggttgaaggcttt
gaagatcagatagagatcatgtcttatagccacaatgtggcaatgcaggtaaataacgat
gttagcctcactgagcggacttccgggcgcgcgcatgttggtgaaatgtcgctcaccaaa
tttgtcgacctcgccacgcctgtgctcaatgagtactgctgtagcgggaggctaattaga
accgcggtgctgacgttgtgccgcaatgacgacggcaaaatgcggtcgcttatcgtttat
accctgacaaacgtgctgatatcacaactcagtgttagcggcggcgccggcggtaagccg
gtggaaacgatgtcgctgaacttcacgaaaatcgaatggcaaatcactgccgagaaatca
gacggcgctcagcaggagtccagaacgtcagtatgggatctggcgatgaaccagataggg
aaatga

DBGET integrated database retrieval system