KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_3266Help
Entry
SL1344_3266       CDS       T01724                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00790  Folate biosynthesis
sey01100  Metabolic pathways
Module
sey_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SL1344_3266 (folP)
Enzymes [BR:sey01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SL1344_3266 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CBW19362
UniProt: A0A0H3NGD5
Position
complement(3484442..3485290)
Genome map
AA seq 282 aa AA seqDB search
MKLFAQGATLDLTHPHVMGILNVTPDSFSDGGAHNTLIEAVKHANLMVNAGATIIDVGGE
STRPGAAEVSVEEELDRVIPVLEAIAQRFEVWISVDTSKPEVIREAARAGAHIINDVRSL
SEPGALEAAAETGLPVSLMHMQGNPKTMQEAPKYDDVFAEVNRYFIEQIARCEKAGIAKE
KLLLDPGFGFGKNLSHNYTLLARLGEFHHFNLPLLVGMSRKTMVGQLLNVGPSDRLNGSL
ACAVIAAMQGAQIIRVHDVKETVEAMRVVEATLSAKGNKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttcgctcagggcgccacgctcgatctcactcatccgcatgttatggggatc
ctgaacgtaacgccggattcgttctccgacggcggcgcgcataacacgctgattgaggcg
gtgaaacatgcgaatttaatggtgaatgccggggcgacaattattgatgtggggggggaa
tcaacgcgaccaggcgcggcagaagtgagcgtggaagaagagctggatcgcgttattccg
gtactggaagcaatcgcgcaacgttttgaagtgtggatttctgtggatacctctaaaccc
gaggtgatccgtgaagcggcaagggcgggcgcgcatattatcaatgatgtccgttcactc
tccgaacccggcgcgttggaagcggcagcggaaaccggcttgccggtcagtcttatgcac
atgcagggcaaccctaaaaccatgcaggaggcgccgaaatatgacgatgtctttgccgag
gtgaatcgctactttattgagcaaatagcacgttgtgagaaggccggcatcgcaaaagag
aaattgttgctcgacccaggattcggtttcggtaaaaatctctctcacaattatacctta
ctggcgcgactgggtgagtttcatcattttaacctgccgctgctggtgggcatgtcacgt
aaaacgatggttggtcagttacttaacgtgggaccatcagaccgtctgaacggcagcctt
gcgtgcgcggtaattgccgcgatgcagggcgcgcagatcattcgcgtccatgacgtcaaa
gaaaccgtagaggcgatgcgggtggtggaagccactctgtctgcaaagggaaacaaacgc
tatgagtaa

DBGET integrated database retrieval system