KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_3911Help
Entry
SL1344_3911       CDS       T01724                                 

Gene name
pldA
Definition
(GenBank) detergent-resistant phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00564  Glycerophospholipid metabolism
sey00565  Ether lipid metabolism
sey00590  Arachidonic acid metabolism
sey00592  alpha-Linolenic acid metabolism
sey01100  Metabolic pathways
sey01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sey00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SL1344_3911 (pldA)
   00565 Ether lipid metabolism
    SL1344_3911 (pldA)
   00590 Arachidonic acid metabolism
    SL1344_3911 (pldA)
   00591 Linoleic acid metabolism
    SL1344_3911 (pldA)
   00592 alpha-Linolenic acid metabolism
    SL1344_3911 (pldA)
Enzymes [BR:sey01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     SL1344_3911 (pldA)
    3.1.1.32  phospholipase A1
     SL1344_3911 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: CBW20002
UniProt: A0A0H3NJN9
Structure
PDB: 

Position
4183291..4184037
Genome map
AA seq 248 aa AA seqDB search
MLQEHDNPFTLYPYDTNYLIYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGI
LGPNSVLGASYTQKSWWQLSNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYN
HDSNGRSDPTSRSWNRLYTRLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGY
HLGEAVLSAKGQYNWNTGYGGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGV
GVMLNDIF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttgatc
tacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaaaac
gcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcggaata
ctggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctttcc
aacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttcttggt
tttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctacaac
catgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacccgt
ctgatggccgaaaacggtaactggctggtagaggtcaaaccgtggtacgtgattggcagt
accgatgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggttat
cacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctacggc
ggcgcggaagttggattaagctatccggtcactaaacatgtccggctttatacccaggtg
tacagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggcgtc
ggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system