KEGG   Salmonella enterica subsp. enterica serovar Typhimurium SL1344: SL1344_4299Help
Entry
SL1344_4299       CDS       T01724                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sey  Salmonella enterica subsp. enterica serovar Typhimurium SL1344
Pathway
sey00230  Purine metabolism
sey00250  Alanine, aspartate and glutamate metabolism
sey01100  Metabolic pathways
Module
sey_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sey00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SL1344_4299 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SL1344_4299 (purA)
Enzymes [BR:sey01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SL1344_4299 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: CBW20385
UniProt: A0A0H3NKT7
Position
4629676..4630974
Genome map
AA seq 432 aa AA seqDB search
MGNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGI
LRENVTSIIGNGVVLSPSALMKEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREK
ARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAE
AVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEYGA
TTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTP
LAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDR
TETMILRDPFDA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaacgtcgtcgtactgggcacccaatggggtgacgaaggtaaaggaaagatc
gtcgatcttctgactgaacgggctaaatatgttgtacgctaccagggcggtcacaacgca
ggccatactctcgtaatcaacggtgaaaaaaccgttctccatcttattccatcaggtatt
cttcgcgagaatgtaaccagcatcatcggtaacggtgttgtgctgtctccgagcgcgctg
atgaaagagatgaaagaactggaagaccgtggcatccccgttcgtgagcgtctgctgctg
tctgaagcctgtccgctgatccttgattatcacgttgcgctggataacgcgcgtgagaaa
gcgcgtggcgcgaaagcgatcggcaccaccgggcgtggaatcgggcctgcttatgaagat
aaagtggcacgtcgcggtctgcgtgttggtgaccttttcgacaaagaaaccttcgctgaa
aaactgaaagaagtgatggaatatcacaacttccagttggttaactactacaaagctgaa
gcggttgattaccagaaagttctggatgatacgatggctgttgccgacatcctgacttct
atggttgttgacgtttcggacctgctcgaccaggcgcgtcagcgtggcgatttcgtcatg
tttgaaggtgcgcagggtaccctgctggatatcgaccacggtacttatccgtacgtaact
tcttctaacaccactgcaggtggcgtggcgaccggttccggcctgggcccgcgttatgtt
gattacgttctgggtatcctcaaagcttactccactcgcgtaggtgcgggtccgttcccg
accgaactgtttgatgaaaccggcgagttcctctgcaagcagggtaacgaatatggcgct
actaccggccgtcgtcgtcgtaccggctggctggacaccgttgccgttcgtcgtgcggta
cagctgaactccctgtctggcttctgcctgaccaaactggacgtgctggatggcctgaaa
gaggtgaaactctgcgtggcttaccgtatgccggatggtcgcgaagtgactaccactccg
ctggcagctgacgactggaaaggtgtagagccgatttacgaaaccatgccgggctggtct
gaatccaccttcggcgtgaaagatcgtagcggtctgccgcaggcggcgctgaactacatc
aagcgtattgaagaactgaccggcgtgccgattgatattatttctaccggccccgatcgt
actgagacgatgattctgcgcgacccgttcgacgcgtaa

DBGET integrated database retrieval system