KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0227Help
Entry
Sez_0227          CDS       T00746                                 

Gene name
gltX
Definition
(GenBank) glutamyl-tRNA synthetase; Glutamyl-tRNA(Gln) synthetase
  KO
K09698  nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00970  Aminoacyl-tRNA biosynthesis
sez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sez00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sez_0227 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sez01007]
    Sez_0227 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sez03016]
    Sez_0227 (gltX)
Enzymes [BR:sez01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Sez_0227 (gltX)
Amino acid related enzymes [BR:sez01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Sez_0227 (gltX)
Transfer RNA biogenesis [BR:sez03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Sez_0227 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ACG61605
UniProt: B4U0R8
Position
250356..251801
Genome map
AA seq 481 aa AA seqDB search
MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFVIRIEDTDRKRHVEDGERSQL
ENLRWLGIDWDESPETHERYRQSERLALYQQYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYVNEYLGMSADEKAAYIAEREAAGIVPTVRLAVNEAGIYKWTDMVKGDIVFEG
GNVGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPV
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEAEIFSR
EQLIALFDESRLSKSPAAFDQKKMDWMSNEYFKHADLGAVYALCKPFLEAAGRLTEKAEK
LVELYQPQLSSADEIVPLTDLFFSDFPELTAKEKEVMAAETVPTVLKAFKEKLEAMSDED
FKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGREQSIEHIANM
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaattcgtgtgcgctacgcaccaagcccaacaggtcttttacatatcgga
aatgcgcggacagcgctctttaactatctttatgctcgtcatcatggcggtgactttgtt
attcgtattgaggatactgatcgtaagcgccatgtcgaggacggtgagcgttctcagctg
gaaaatttgagatggcttggtatagattgggacgaaagccctgagacgcatgagcgttac
cgtcagtcagagcgtctagctctttatcaacagtacattgaccaattattagcagaaggc
aaggcctacaagtcttatgtgactgaggaggagttggcagcagagcgtgagcgtcaagag
gcagctggtgaaacacctcgctatgtcaatgaatatcttggcatgtcagcagatgaaaag
gcggcctatattgcagagcgtgaagcagcaggtattgtgcctacggttcgtttggctgtc
aatgaggctggtatttacaaatggacagacatggtaaaaggcgatatcgtatttgagggt
ggcaatgtcggtggtgactgggtaatccagaaaaaagacggctatccaacctacaatttt
gctgttgttattgatgatcacgatatgcaaatctcacacgttatccgcggagatgaccat
attgccaatacgccaaagcagttgatggtttacgaggcgcttggctgggaagcacccgtc
tttggtcatatgacccttatcattaattctgagacaggtaaaaagctatcaaagcgtgat
accaataccctgcagtttattgaggattaccgcaaaaaaggctatatgccagaggcagtc
tttaattttattgcccttttaggctggaatcctggcggggaggctgagatcttttctcgt
gagcaattgattgccttatttgatgagagtcgtcttagcaagtcgccagcagcctttgat
cagaaaaaaatggactggatgagcaatgagtactttaagcatgctgatcttggcgctgta
tatgcgctttgtaagccatttcttgaagcagcaggccgcttgactgaaaaagcagagaag
ctagttgagctctatcagcctcaattaagctctgctgatgagattgttccattgactgat
ttatttttctcagatttcccagagctgaccgcaaaagaaaaagaagtgatggcagctgag
actgttccaacagttctgaaggccttcaaggaaaagctagaggcgatgtcagatgaggac
tttaagccagaaaacattttcccacaaatcaaggctgtccaaaaagaaaccggcattaag
ggcaagaacctctttatgccaattcgtattgctgtttctggagaaatgcatggcccagag
ctgccaaataccatttacctccttggacgtgaacaatcgattgagcatattgccaatatg
ctttaa

DBGET integrated database retrieval system