KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0641Help
Entry
Sez_0641          CDS       T00746                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sez00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sez_0641 (recR)
DNA repair and recombination proteins [BR:sez03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Sez_0641 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sez_0641 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim Pox_Rap94 DUF3874
Motif
Other DBs
NCBI-ProteinID: ACG62008
UniProt: B4U1Z1
Position
660769..661365
Genome map
AA seq 198 aa AA seqDB search
MLYPIPIAKLIESYSKLPGIGVKTATRLAFYTIGMSDEDVNDFAKNLLAAKRELTYCSIC
GNLTDDDPCHICTDSSRDKETILVVEASKDVSAMEKIQEYHGYYHVLHGLISPMNGVGPD
DINLKSLITRLMAGEATEVIVATNATADGEATAMYISRILKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgctttaccctataccaatcgcaaaattaattgaaagctattctaaattaccagggatt
ggtgttaaaacagcgacaagattggctttttacaccattggaatgtctgatgaggatgtg
aatgattttgccaaaaatttattagcagctaagcgagaattaacctattgctccatctgt
ggcaatttgacagatgatgatccctgccatatttgcacagatagcagtcgggataaagag
actattttagttgttgaggcttccaaggacgtttctgctatggaaaaaattcaagaatat
catggctattaccatgtgctgcatggcttgatttctcccatgaatggggttggtccagat
gacatcaatctaaagagcctaatcacgcgtttgatggctggagaggcaacggaggtcatt
gttgcaacgaatgccacagcagatggagaggcgactgcgatgtacatttcacgtatccta
aagcctgctggtatcaaggtaacgagattggctagaggcttggcagtaggatcagacatt
gaatatgctgatgaagtgaccctgctgcgagcgattgaaaatcgaacagaattatag

DBGET integrated database retrieval system