KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0881Help
Entry
Sez_0881          CDS       T00746                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00010  Glycolysis / Gluconeogenesis
sez00030  Pentose phosphate pathway
sez00051  Fructose and mannose metabolism
sez00052  Galactose metabolism
sez00680  Methane metabolism
sez01100  Metabolic pathways
sez01110  Biosynthesis of secondary metabolites
sez01120  Microbial metabolism in diverse environments
sez01130  Biosynthesis of antibiotics
sez01200  Carbon metabolism
sez01230  Biosynthesis of amino acids
sez03018  RNA degradation
Module
sez_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sez00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_0881 (pfkA)
   00030 Pentose phosphate pathway
    Sez_0881 (pfkA)
   00051 Fructose and mannose metabolism
    Sez_0881 (pfkA)
   00052 Galactose metabolism
    Sez_0881 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Sez_0881 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Sez_0881 (pfkA)
Enzymes [BR:sez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sez_0881 (pfkA)
Protein phosphatases and associated proteins [BR:sez01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sez_0881 (pfkA)
Messenger RNA biogenesis [BR:sez03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Sez_0881 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACG62239
UniProt: B4U2M2
Position
924470..925483
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINRGYAGMVDGDIFPLGSKEVGDK
ISRGGTFLYSARYPEFAQLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAIDKLRDTSSSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEFDIHKVVSTIKDDFENRGKNHHIIVLAEGVMSGEAFAQQLKEAGD
ESDLRVTNLGHILRGGSPTARDRVIASWMGAHAVELLKEGKGGLAVGIHNEELVESPILG
SAEDGALFSLTDEGNIVVNNPHKARLDYAALNRSLAQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaaccagtggtggtgacgcccctggtatgaatgctgctatt
cgtgcagttgttcgtaaagcaatttcagaaggaatggaagtctatggtattaaccgcggc
tatgctggtatggttgatggtgatatctttccactaggctcaaaagaggttggtgataag
atttctcgcggcgggaccttcctttattcagctcgctacccagagtttgctcagcttgag
gggcaattggctggtattgagcagctaaaaaagcatggcattgaaggggtagttgtcatt
ggtggtgatggttcttaccatggtgcgatgcgcttgactgagcatggcttccctgcagta
ggtatcccagggacgattgataacgatattgctggaacagactatactatcggatttgac
actgcggtcaatactgcggtagaggctattgataagcttcgcgatacctcatcaagtcat
ggacggacctttgttgttgaagtgatgggacgtaatgcaggtgatatcgcactttgggca
ggtattgcaagtggagcagatcaaatcatcgttcctgaagaggaatttgacattcataaa
gtggtctcaacaattaaagacgattttgaaaatagaggaaaaaatcaccatattatcgtt
ttagctgagggtgttatgagtggcgaggcctttgcgcagcagctaaaagaagctggagat
gaaagtgaccttcgtgtgacaaaccttggtcatatccttcgcggtggctctccaactgcg
cgtgatcgtgtgattgcgtcatggatgggagcgcacgctgttgagctgctcaaggaaggc
aaaggcggcttggctgttggtattcataatgaagagcttgttgaaagtccgattcttgga
agtgcagaggacggtgccttgttcagccttactgatgagggtaacattgttgttaataat
ccgcacaaggctcgcttagactatgctgctttgaaccgttcattagcgcaatag

DBGET integrated database retrieval system