KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_0943Help
Entry
Sez_0943          CDS       T00746                                 

Gene name
coaC
Definition
(GenBank) probable phosphopantothenoylcysteine decarboxylase CoaC
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00770  Pantothenate and CoA biosynthesis
sez01100  Metabolic pathways
Module
sez_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sez00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Sez_0943 (coaC)
Enzymes [BR:sez01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Sez_0943 (coaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ACG62301
UniProt: B4U2T4
Position
complement(981127..981672)
Genome map
AA seq 181 aa AA seqDB search
MTKQITLAVSGSISAYKAADLTSQLIKKGYEVTVLMTQAATAFITPLTLQVLSKNPVHLD
VMAEHDVKIVNHIELAKVTDLFVLAPASANTIAHLAYGFADNMVTSVALALPETTPKLIA
PAMNTNMYLNPITQQNLKRLADLGFREIPPKTALLACGDTGPGALADIDDIVTAISQQLA
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcagataacacttgcagtctctggtagtatttctgcctataaggcagctgat
ctcaccagtcaattaatcaaaaaaggctatgaggttactgtgctgatgacacaagcagct
actgctttcatcactccgttgaccctacaggtcttatcaaaaaatcctgtccatttagac
gtcatggcagagcatgatgtcaaaattgtcaaccatatcgagctagctaaagtaacagat
ctatttgtccttgctcctgcaagtgccaataccattgctcatttagcctatggctttgct
gataatatggttaccagtgtcgccctagccctacctgagacaacacccaaactcatcgct
cctgctatgaatactaacatgtaccttaacccaattactcagcaaaacctcaaacgctta
gccgatcttggctttcgagaaataccacctaagacagccctgcttgcctgcggcgacaca
ggacctggtgccttagcagatattgatgatatagtcacagcaattagtcagcagctagca
agatag

DBGET integrated database retrieval system