KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1080Help
Entry
Sez_1080          CDS       T00746                                 

Gene name
hmgA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase HmgA
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00900  Terpenoid backbone biosynthesis
sez01110  Biosynthesis of secondary metabolites
sez01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sez00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sez_1080 (hmgA)
Enzymes [BR:sez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     Sez_1080 (hmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ACG62432
UniProt: B4U365
Position
1115296..1116582
Genome map
AA seq 428 aa AA seqDB search
MMTKTKPNWAGFYKKSLAERIQQLADDQLLGPQQQKLLETDQLLPIAIANQMTENVIGRL
ALPFSLAPDFLINGHTYQVPFVTEEPSVVAAASFAAKIIKRSGGFQTEVLSRQMLGQVAL
YDVKDDEQARLAILANADTLIDIANNAYPSIVKRGGGAKSLTVERKEDFFIVYLSVDTQE
AMGANIVNTMMEALVPDLEALSGGQCLIAILSNYATKALVSARCQVDLRYLSRHKEEAQQ
LAKKIELASKLAQIDPYRAATHNKGIFNGIDAVAIATGNDWRAIEAGAHAYAARNGAYRG
LSSWHVDTSKNSLCGELTLPMPIASKGGSIGLNPTVNVARSLLEQPNAKVLAQIITAVGL
AQNFAALKALTSTGIQAGHMKLQAKSLALLAGASEQEVPQLVKALLKDKPMNLEKAGQLL
TAIRLSQS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaaaactaaaccaaattgggccggcttttataaaaaaagccttgcagaacgc
attcaacagctcgcagatgaccagctgcttggcccgcagcagcaaaagctgttagagaca
gaccagctcttacccattgctattgccaatcaaatgaccgaaaatgtcatcggtcgactg
gctctgccttttagtctagcccctgattttctgatcaatgggcatacctatcaggtcccc
tttgtgactgaagagccttctgttgttgctgctgcttcctttgctgccaaaatcatcaag
cgatcaggtggctttcagactgaggtactcagtcgtcaaatgcttgggcaggtagctctt
tatgatgttaaagatgacgagcaggctaggctggctattctagctaacgcagatacattg
attgatattgcaaacaatgcctacccttctattgttaagcgtggtggtggtgcaaagagc
cttactgttgagcgtaaggaggactttttcattgtctatctgagcgttgatacccaagag
gctatgggagccaacatcgttaacacgatgatggaggctttagtacctgatttggaggcc
ctaagcggtggtcaatgcttaatagctatcctctcaaactatgcaacaaaagctctagtt
agtgctaggtgtcaggttgacctcagatacttaagtcgacataaggaagaagcccagcaa
ttagccaaaaaaatagaactggcaagtaaactagcgcagattgacccttaccgagcagca
acgcataataagggaatcttcaatggaatcgacgcagtagctatagctactggaaatgac
tggagagctattgaggctggagcacatgcctacgccgcaaggaatggcgcttatagagga
ctaagtagctggcacgttgatacatctaaaaatagcttatgtggagagttaacactgcca
atgcccattgccagtaaagggggctcgattggtctcaacccaactgtcaatgttgctcgc
agccttttagagcaaccaaatgccaaggtactcgcccaaatcatcaccgcagttgggttg
gcgcaaaattttgctgctctaaaggccttgacctcaactggtattcaggctggtcacatg
aagctgcaggccaagtctctagctctattagcaggtgctagtgagcaggaggtgcctcaa
ctagtcaaggctttactaaaggataagccaatgaacctagaaaaggcaggacagctctta
acagccatacgattaagccaatcatag

DBGET integrated database retrieval system