KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1399Help
Entry
Sez_1399          CDS       T00746                                 

Definition
(GenBank) putative acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00071  Fatty acid degradation
sez00072  Synthesis and degradation of ketone bodies
sez00280  Valine, leucine and isoleucine degradation
sez00310  Lysine degradation
sez00362  Benzoate degradation
sez00380  Tryptophan metabolism
sez00620  Pyruvate metabolism
sez00630  Glyoxylate and dicarboxylate metabolism
sez00640  Propanoate metabolism
sez00650  Butanoate metabolism
sez00900  Terpenoid backbone biosynthesis
sez01100  Metabolic pathways
sez01110  Biosynthesis of secondary metabolites
sez01120  Microbial metabolism in diverse environments
sez01130  Biosynthesis of antibiotics
sez01200  Carbon metabolism
sez01212  Fatty acid metabolism
sez02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sez_1399
   00630 Glyoxylate and dicarboxylate metabolism
    Sez_1399
   00640 Propanoate metabolism
    Sez_1399
   00650 Butanoate metabolism
    Sez_1399
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sez_1399
   00072 Synthesis and degradation of ketone bodies
    Sez_1399
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sez_1399
   00310 Lysine degradation
    Sez_1399
   00380 Tryptophan metabolism
    Sez_1399
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sez_1399
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sez_1399
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sez_1399
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sez04147]
    Sez_1399
Enzymes [BR:sez01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sez_1399
Exosome [BR:sez04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sez_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACG62735
UniProt: B4U418
Position
complement(1438156..1439271)
Genome map
AA seq 371 aa AA seqDB search
MIDVYIQRGLRTPIGLAGKQFARVRPELLGAQLINALVKADKLAIDEVICGNAVGTGGNI
GRLMTLYSDLGETVPATTVDMQCASAGAALTMGYAKIKAGLATSLLAGGIESSSLQPQRI
YAAADSRSGAYEVAQFSPDTSSQLAMIAGAERVAQTYQMTPSQLNQWTLTSHQRAHTARQ
KHWLADIILAMPGMSDQGIRPRLSEKVLSKVPPILDKAGLISAANTCLTHDAAAFLVLSS
QRSAYQILDLVEVAGNPKTSPQMVVEASQVLLARNGLAMTDMDAIEWNEAFAVIDLLFEH
YFVEALDRYNIFGGALAYGHPFGASAAIIILHLMQALALKQGRYGLAAIPAAGGQAFALL
LEYHKDYSHAI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtctacattcaaagagggcttagaacgcctattggtctagctggcaagcaa
tttgctagggtgcgtccagagctgcttggtgctcagctgattaatgccttagtcaaagca
gataagctggctattgatgaggtgatctgcggtaatgctgttgggacaggcggtaatatt
ggccggctgatgactctgtattctgacttgggagagactgtacctgctacaactgttgac
atgcaatgtgcctcggctggtgcagctcttacgatgggctatgccaaaatcaaggcaggt
cttgccactagcttgttagcaggagggatcgaaagcagctctttgcagccccagcgtatc
tatgctgctgctgatagtcgatcgggcgcttatgaggtggcacaattttctccagacaca
agcagtcagctggctatgatagcaggagcagagcgggtggcccagacctaccaaatgaca
ccctcgcagctcaaccaatggacccttactagccaccagcgagcacacacagctaggcag
aagcattggttagctgatattatattagcaatgccaggtatgtctgatcagggcattcgc
cctcgcctgtcagaaaaggtcttgagcaaggtgccgccgatacttgataaggccggcctc
atcagtgctgctaatacctgcttgacccatgacgcagcagcatttttagtgctaagcagt
caaagatcagcctatcaaatccttgatcttgttgaggttgctggcaatcctaaaaccagt
cctcaaatggtggttgaggccagtcaggtcttattagctagaaacggcctagccatgacg
gatatggatgcgatcgagtggaatgaagcttttgcagtgattgatctgctttttgagcat
tattttgtggaggcccttgatcgctacaatatttttggaggcgctcttgcctacggtcat
ccctttggcgcgtcagcagccattatcattttgcatctaatgcaggctttggccttaaag
caaggaaggtatggtttagcagccattccagcagctggtggtcaagcctttgccctgtta
ttggaatatcataaggactactcacatgctatctag

DBGET integrated database retrieval system