KEGG   Streptococcus equi subsp. zooepidemicus MGCS10565: Sez_1717Help
Entry
Sez_1717          CDS       T00746                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase Fba
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
sez  Streptococcus equi subsp. zooepidemicus MGCS10565
Pathway
sez00010  Glycolysis / Gluconeogenesis
sez00030  Pentose phosphate pathway
sez00051  Fructose and mannose metabolism
sez00680  Methane metabolism
sez01100  Metabolic pathways
sez01110  Biosynthesis of secondary metabolites
sez01120  Microbial metabolism in diverse environments
sez01130  Biosynthesis of antibiotics
sez01200  Carbon metabolism
sez01230  Biosynthesis of amino acids
Module
sez_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sez_1717 (fba)
   00030 Pentose phosphate pathway
    Sez_1717 (fba)
   00051 Fructose and mannose metabolism
    Sez_1717 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    Sez_1717 (fba)
Enzymes [BR:sez01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Sez_1717 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase ThiG TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ACG63046
UniProt: B4U4X9
Position
complement(1767275..1768243)
Genome map
AA seq 322 aa AA seqDB search
MRGWKFLENCAKMNNVNGVNPKYKRRLIKMPIVSAEKFVQAARDNGYAVGGFNTNNLEWT
QAILRAAEAKQAPVLIQTSMGAAKYMGGYKLAKVLIETLVESMNITVPVAIHLDHGHYED
ALECIEVGYTSIMFDGSHLPVEENLEKAREIVKLAHAKGVSVEAEVGTIGGEEDGIIGSG
ELAPIEDAKAMVATGIDFLAAGIGNIHGPYPENWTGLDLDHLKKLTDAVPGFPIVLHGGS
GIPDDQIQAAIKLGVAKVNVNTECQIAFANATRAFARDYEANVAEYDKKKLFDPRKFLAD
GVKAIQASVEERIDVFGSANKA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaggggctggaaatttcttgaaaattgtgctaaaatgaacaatgtaaatggggttaac
ccaaaatataagaggaggcttattaaaatgccaatcgtttcagcagaaaaatttgtccaa
gcagcacgtgataacggctatgctgttggtggatttaacacaaacaaccttgaatggact
caagcaatcctgcgtgcagcagaagctaaacaagctcctgttcttatccaaacctcaatg
ggtgcagctaaatacatgggtggctataagctggctaaggttcttatcgaaactcttgta
gaatcaatgaacatcactgtcccagttgcgatccaccttgatcatggtcactatgaagat
gctcttgaatgtattgaggttggttacacttcaatcatgtttgacggttcacaccttcca
gttgaagaaaaccttgaaaaagcacgtgaaattgttaagctagcacatgctaagggtgtt
tccgttgaagctgaggtaggtacaattggtggtgaagaagacggtatcatcggtagtggt
gagcttgctccgattgaagacgctaaggcaatggttgctacaggaattgacttcttggct
gcaggtattggtaatatccatggaccatacccagaaaactggactggtcttgatctagat
cacttgaagaaattgactgatgctgtaccaggcttcccaatcgtgcttcatggtggttca
ggtattcctgatgaccaaattcaagcagctatcaagcttggtgttgcaaaggttaatgtt
aatacagagtgtcaaattgcatttgctaacgctactcgtgcctttgcgcgtgattacgaa
gcaaacgttgcagaatacgataagaaaaaactctttgacccacgtaaattcttggcagat
ggtgttaaggcgatccaggcttctgttgaagaacgtattgatgtctttggctcagcaaac
aaggcttaa

DBGET integrated database retrieval system