KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00065Help
Entry
SeseC_00065       CDS       T02355                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
sezo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sezo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SeseC_00065 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sezo03011]
    SeseC_00065 (rplV)
Ribosome [BR:sezo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SeseC_00065 (rplV)
  Bacteria
    SeseC_00065 (rplV)
  Archaea
    SeseC_00065 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEJ24288
Position
66373..66717
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPNKAARVIEKTLNSAIA
NAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKHTTHVTVVVSEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtgcgtgtttcacctcgtaaa
acacgtttagtacttgatcttatccgtggtaagaaagttgctgatgcaatcgcaatctta
aaattcactccaaacaaagcagctcgtgttattgagaaaactcttaactcagcaattgct
aacgcagaaaataactttggtttggaaaaagctaacttggtggtatctgaaacatttgca
aacgaaggaccaacaatgaaacgtttccgtccacgtgcaaaaggctcagcgtcaccaatc
aacaagcatacaactcacgttacagtagttgtatcagaaaaataa

DBGET integrated database retrieval system