KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_00965Help
Entry
SeseC_00965       CDS       T02355                                 

Gene name
gpo
Definition
(GenBank) glutathione peroxidase Gpo
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
sezo00480  Glutathione metabolism
sezo00590  Arachidonic acid metabolism
sezo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sezo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SeseC_00965 (gpo)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SeseC_00965 (gpo)
Enzymes [BR:sezo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SeseC_00965 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEJ25007
Position
complement(797266..797769)
Genome map
AA seq 167 aa AA seqDB search
MTSIYDFSVKRQDGTDCSLEQYQGKVLLVVNTATKCGLTPQYQALQELYDTYREKGFEIL
DFPCNQFLHQAPGDATEINAFCSLTYHTTFPRFAKIKVNGKETEPLFTWLKEQKSGPLGK
RIEWNFAKFLIDQKGQVVERYASKTDPKMIETALQRLLFQEPIDQSD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgactagcatttatgactttagcgttaaaagacaagatggcactgattgttcactggag
caataccaaggaaaggtcctattagtggtcaacaccgccactaaatgcggattaactcct
caatatcaagcattacaggagctctatgacacctacagggaaaagggctttgaaatcctt
gatttcccctgcaaccaattcttacatcaagcaccgggtgatgctacagaaatcaatgcc
ttttgtagcttaacctaccacaccacctttccacgctttgccaaaatcaaggttaatggc
aaggagacagagccattattcacttggctcaaggaacaaaaaagtggcccactcggcaag
cgcatcgaatggaacttcgcaaaatttttaattgatcaaaaggggcaggttgttgagcgc
tatgcctcaaaaacagaccccaaaatgattgaaacagccctacagcgattgctcttccaa
gagccaattgaccaatcagactaa

DBGET integrated database retrieval system