KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_01421Help
Entry
SeseC_01421       CDS       T02355                                 

Gene name
pksG
Definition
(GenBank) 3-hydroxy-3-methylglutaryl coenzyme A synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
sezo00072  Synthesis and degradation of ketone bodies
sezo00280  Valine, leucine and isoleucine degradation
sezo00650  Butanoate metabolism
sezo00900  Terpenoid backbone biosynthesis
sezo01100  Metabolic pathways
sezo01110  Biosynthesis of secondary metabolites
sezo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sezo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SeseC_01421 (pksG)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SeseC_01421 (pksG)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SeseC_01421 (pksG)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SeseC_01421 (pksG)
Enzymes [BR:sezo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SeseC_01421 (pksG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N S6OS1
Motif
Other DBs
NCBI-ProteinID: AEJ25383
Position
1193095..1194273
Genome map
AA seq 392 aa AA seqDB search
MNIGIDKIGFATSQYVLKMEDLALARSTDPAKFHQGLMLDALSIAPVTEDIVTLAASAAD
QILTKDDKASIDMVILATESSIDQSKAASIYVHQLLDIQPFARSFEIKEACYSATAALDY
AKLHVAAHPASKVLVIASDIAKYGIGSAGEPTQGAGSIAMLVTTNPRILQLNHDNVAQTR
DVMDFWRPNYSSTPFVNGIYSTKQYLDSLKTTWDKYQEKEGIELSDLAAICFHIPFPKLA
LKGLHKIMTKSLLADNHKEKLYENFQASIAYSKQIGNIYTGSLYLGLLSLLENSQVLRAG
DRIGLFSYGSGAVSELFSGQLVDGYKDMLLTNRQALLDQRQVISVADYEALFYEEPSLDQ
DGNASFSPYLTGRFALKEIKEHQRIYQDDDKN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggaattgataagattggctttgcgaccagtcaatacgtcttaaaaatggaa
gacctggcacttgctcgcagcactgatccagcaaaatttcatcaggggctaatgcttgac
gctctaagcattgcacctgttacagaggatattgtaacgcttgctgcatcagctgctgac
caaatccttaccaaagacgataaagcaagcattgacatggtcattttagcaaccgaatca
agcattgatcaatcaaaggcagccagtatttacgttcatcagctgcttgatattcagccc
tttgcacgctcctttgagataaaggaagcctgctacagcgctactgctgctttagattat
gccaaattacatgttgctgcacacccagcctccaaggtcttggtcattgccagtgacatc
gccaaatacggcattggatccgccggagagccaacacaaggtgctggaagtattgctatg
ctagttactactaatcctcgtattctccagttaaatcatgacaatgtcgcacagacacgt
gatgtgatggatttttggcgtccaaattacagctcaacaccatttgtcaatggtatttat
tcgaccaagcagtaccttgattccctaaaaacaacctgggacaaatatcaagaaaaagaa
ggcattgagctatcagaccttgctgctatctgttttcatatcccctttccaaagcttgct
ctaaaggggcttcataagatcatgacaaaatcgctactagcagataaccacaaagaaaaa
ctctacgaaaactttcaggcttctattgcctacagcaagcaaatcgggaacatttacaca
ggctcactctacctcggcttattatcacttttagagaatagtcaggtattaagagctggt
gatcggattggattgtttagctatggctcaggagctgttagtgagctgttttcagggcag
cttgttgacggttacaaggacatgctactgactaatcgacaagccctattagaccaacgt
caagtgatttcagtagctgattatgaagcacttttttatgaagagcctagtctagatcaa
gatggcaatgccagcttttcaccctatctaactggcaggtttgccctcaaagaaattaag
gaacaccaacgaatttatcaagatgatgacaaaaactaa

DBGET integrated database retrieval system