KEGG   Streptococcus equi subsp. zooepidemicus ATCC 35246: SeseC_01935Help
Entry
SeseC_01935       CDS       T02355                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sezo  Streptococcus equi subsp. zooepidemicus ATCC 35246
Pathway
sezo00071  Fatty acid degradation
sezo00072  Synthesis and degradation of ketone bodies
sezo00280  Valine, leucine and isoleucine degradation
sezo00310  Lysine degradation
sezo00362  Benzoate degradation
sezo00380  Tryptophan metabolism
sezo00620  Pyruvate metabolism
sezo00630  Glyoxylate and dicarboxylate metabolism
sezo00640  Propanoate metabolism
sezo00650  Butanoate metabolism
sezo00900  Terpenoid backbone biosynthesis
sezo01100  Metabolic pathways
sezo01110  Biosynthesis of secondary metabolites
sezo01120  Microbial metabolism in diverse environments
sezo01130  Biosynthesis of antibiotics
sezo01200  Carbon metabolism
sezo01212  Fatty acid metabolism
sezo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sezo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeseC_01935 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SeseC_01935 (atoB)
   00640 Propanoate metabolism
    SeseC_01935 (atoB)
   00650 Butanoate metabolism
    SeseC_01935 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    SeseC_01935 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SeseC_01935 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SeseC_01935 (atoB)
   00310 Lysine degradation
    SeseC_01935 (atoB)
   00380 Tryptophan metabolism
    SeseC_01935 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SeseC_01935 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SeseC_01935 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SeseC_01935 (atoB)
Enzymes [BR:sezo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SeseC_01935 (atoB)
Exosome [BR:sezo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SeseC_01935 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AEJ25784
Position
complement(1606486..1607676)
Genome map
AA seq 396 aa AA seqDB search
MLVKEVVITTAVRTPIGSFGGAFKSVSAVQLGKIVVEALLEKSGLKPEQIDEVIFGNVLH
AGLGQNVARQVAITAGIPNDKPAFTVDMVCGSGLKSIELAAQSIVCGDSEIIIAGGTENM
SQASYVLKDYRWGGRLGDGKIIDTMVNDGLTDAFHDYHMGITAENIAKNYGISRKAQDIF
ALASQEKAAAAQAAGRFVDEIIPVPVPQRKGDPILVAEDEYIKAGTTLEKLTALRPAFVR
DGSGTVTAGNASGINDGAAAVLLMSRDKAEELGLPILGVIKGYASAGVAPEVMGTGPIPS
TQKALAKVGWTVEDLDLVEANEAFASQAISVVDELGLNADIVNVNGGAIALGHPIGASGA
RILVTLLHEMEKRQAHKGLATLCIGGGQGTSVLIEK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttggttaaagaagttgttatcactacagccgttagaacacccattggttcatttggt
ggagccttcaagtctgtttcggctgttcaattaggaaaaatagttgtagaagcattacta
gagaaatcaggtttgaagcctgaacaaattgatgaggtcattttcggaaatgtcctccat
gcaggacttggtcaaaatgttgctagacaggtagcgataactgcaggtattccaaacgac
aaacctgccttcactgtggatatggtctgtggttctggtctcaaatccatcgagttagca
gcacaaagtatcgtctgtggtgattcagagatcattattgcaggtggtacagaaaatatg
agccaagccagctatgtgctcaaagattaccgctggggtggtcgcttaggcgatggaaaa
atcattgatactatggtcaatgatggtttgacagatgcttttcatgattaccacatggga
attacagcagaaaatatcgcaaaaaactatgggattagccgtaaagctcaagatatattt
gctttggctagtcaggaaaaagctgctgctgcgcaagctgctggtcgctttgtagatgag
attattccagtgccagtaccgcaacgtaaaggtgatccaattttggtggcagaagatgag
tacattaaagctggaacaacccttgaaaaattaacagcccttcgtccggcctttgtccga
gatggttcaggaactgttactgcaggaaacgcttcaggaattaatgacggtgcggcagct
gtccttctcatgagtcgtgacaaagctgaagaacttggtcttccaattctgggagtcatt
aaaggttatgcaagtgctggtgtagcaccagaggtcatgggtactgggccaattccttcc
actcagaaggcccttgctaaggttggttggacggttgaagacctggatttggtagaagct
aatgaagcttttgcctcacaagctatcagtgtggtagatgagcttggtcttaatgcagat
atcgttaatgtcaatggtggtgctattgctcttggtcatccgatcggtgctagtggtgcg
cgtatcttggtaacactattgcacgagatggaaaagcgtcaggcgcataaaggattggca
acactttgcatcggtggcggtcaagggacatctgtattgattgaaaaataa

DBGET integrated database retrieval system