KEGG   Streptomyces pratensis: Sfla_0678
Entry
Sfla_0678         CDS       T01647                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00071  Fatty acid degradation
sfa00280  Valine, leucine and isoleucine degradation
sfa00281  Geraniol degradation
sfa00310  Lysine degradation
sfa00362  Benzoate degradation
sfa00380  Tryptophan metabolism
sfa00410  beta-Alanine metabolism
sfa00640  Propanoate metabolism
sfa00650  Butanoate metabolism
sfa00903  Limonene and pinene degradation
sfa00930  Caprolactam degradation
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01200  Carbon metabolism
sfa01212  Fatty acid metabolism
Module
sfa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Sfla_0678
   00650 Butanoate metabolism
    Sfla_0678
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sfla_0678
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sfla_0678
   00310 Lysine degradation
    Sfla_0678
   00380 Tryptophan metabolism
    Sfla_0678
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sfla_0678
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sfla_0678
   00281 Geraniol degradation
    Sfla_0678
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sfla_0678
   00930 Caprolactam degradation
    Sfla_0678
Enzymes [BR:sfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sfla_0678
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sfla_0678
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sfla_0678
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored Peptidase_S49 AlaDh_PNT_C NAD_binding_8 UDPG_MGDP_dh_N NAD_Gly3P_dh_N Pyr_redox_2
Other DBs
NCBI-ProteinID: ADW02140
UniProt: E8WAF5
Position
complement(787988..790159)
AA seq 723 aa
MTESTTIRWEQDETGVVTLVLDDPNQSANTMNQGFKDSIAAVAARAEAEKDSIRGIIYTS
AKKTFFAGGDLKDMIRIGPENAQAAFDAGTAIKKSLRTIETLGKPVVAAINGAALGGGYE
IALAAHHRVALDAPGTRIGLPEVTLGLLPAGGGVTRTVRLMGITDALLKVLLQGTQYTPR
RALENGLVHEVAATREEMLEKARAFIDAHPESQQPWDVKGYRIPGGTPSNPKFAANLPAF
PANLKKQIAGAPMPAPRNIMAAAVEGSQVDFETAQTIEARYFTELVTGQVAKNMIQAFFF
DLQAVNSGASRPAGVEERQVRKVAVLGAGMMGAGIAYSCARAGIDVVLKDVSTEAAAKGK
AYSEKLLAKALSRGRTTEAKRDELLARITPTGDPADLAGCDAVIEAVFEDTALKHKVFQE
IQDIVEPDALLCSNTSTLPITVLAEGVSRPADFIGLHFFSPVDKMPLVEIIKGEKTGDEA
LARAFDLVRRIKKTPIVVNDSRGFFTSRVIGHFINEGVAMVGEGVEPASVEQAAAQAGYP
AKVLSLMDELTLTLPRKIRDETRRAVEEAGGSWATHPADAVIDRMVDEFGRPGRSGGAGF
YEYGEDGGRGALWPGLREHFTKPGTELPFEDMKERMLFSEALDSVRCLEENVLTTVADAN
IGSIMGIGFPAWTGGVLQYINGYEGGLPGFVARAQQLAERYGDRFLPSAYLVEKAGKGET
FHD
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgaccgagagcacgaccattcgctgggaacaggacgagaccggcgtcgtcaccctcgta
ctcgacgaccccaaccagtccgccaacacgatgaaccagggcttcaaggactccatcgcg
gctgtagccgcgcgtgccgaggccgagaaggactccatccggggcatcatctacacctcc
gcgaagaagaccttcttcgcgggcggcgacctcaaggacatgatcaggatcggtcccgag
aacgcccaggccgcgttcgacgccggaaccgcgatcaagaagtcgctgcgcaccatcgag
acgctcggcaagccggtcgtcgccgccatcaacggcgcggcgctcggcggcggctacgag
atcgcgctggccgcccaccaccgcgtcgccctggacgcccccggcacccgtatcggcctg
cccgaggtcaccctcggcctgctccccgcgggcggcggggtcacgcgtaccgtgcggctg
atgggcatcacggacgccctgctcaaggtcctcctccagggcacccagtacaccccgcgg
cgggcgctggagaacggcctggtccacgaggtcgcggccacccgggaggagatgctcgaa
aaggcacgcgccttcatcgacgcccaccccgagtcgcagcagccctgggacgtcaagggc
taccggatccccggcggcaccccgtcgaacccgaagttcgcggccaacctgcccgccttc
ccggccaacctcaagaagcagatcgccggcgcgcccatgcccgcgccccgcaacatcatg
gccgcggcggtcgaggggtcgcaggtcgacttcgagaccgcgcagaccatcgaggcgcgc
tacttcaccgagctggtcaccggccaggtcgccaagaacatgatccaggcgttcttcttc
gacctccaggcggtcaactccggtgccagcaggccggcgggcgtcgaggagcgccaggtc
cgcaaggtggccgtgctcggcgccgggatgatgggcgccggcatcgcctactcctgcgcc
cgcgccggcatcgacgtcgtcctcaaggacgtctccaccgaggcggccgccaagggcaag
gcctacagcgagaagctcctcgccaaggcgctctcccggggccgcacgacggaggcgaag
cgggacgagctgctggcccggatcaccccgaccggggacccggccgacctcgcgggctgc
gacgccgtgatcgaggcggtcttcgaggacaccgcgctcaagcacaaggtgttccaggag
atccaggacatcgtcgagcccgacgcgctgctgtgctccaacacctcgaccctgcccatc
acggtgctcgccgaaggcgtgagcaggccggcggacttcatcgggctgcacttcttctcg
cccgtcgacaagatgccgctcgtcgagatcatcaagggcgagaagaccggggacgaggcc
ctggcccgtgccttcgacctcgtacgccggatcaagaagacgccgatcgtcgtcaacgac
tcgcgcggcttcttcacctcacgcgtcatcggccacttcatcaacgagggcgtcgcgatg
gtcggggagggcgtcgagcccgcctcggtcgaacaggcggcggcacaggccggctacccg
gcgaaggtcctctccctcatggacgagctgacgctgaccctgccccgcaagatccgtgac
gagacccggcgcgccgtcgaggaggcgggcggcagctgggccacgcatcccgcggacgcg
gtcatcgaccggatggtcgacgagttcgggcggcccgggcgcagcgggggagcgggcttc
tacgagtacggcgaggacggcggccggggcgccctctggccgggcctgcgtgagcacttc
acgaagcccggtaccgagctcccgttcgaggacatgaaggagcggatgctcttctccgag
gcgctggacagcgtccgctgcctggaggagaacgtcctgacgaccgtcgccgacgccaac
atcggctccatcatgggcatcggcttccccgcctggaccggtggagtgctccagtacatc
aacgggtacgagggcggcctgcccggcttcgtggcgcgcgcccagcagctcgccgagcgc
tacggggaccgcttcctgccgtccgcctacctggtggagaaggccgggaagggcgagacc
ttccacgactga

DBGET integrated database retrieval system