KEGG   Streptomyces pratensis: Sfla_0795Help
Entry
Sfla_0795         CDS       T01647                                 

Definition
(GenBank) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00230  Purine metabolism
sfa01100  Metabolic pathways
Module
sfa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sfla_0795
Enzymes [BR:sfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sfla_0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33
Motif
Other DBs
NCBI-ProteinID: ADW02255
UniProt: E8WCG1
Position
complement(918454..919098)
Genome map
AA seq 214 aa AA seqDB search
MSAIVLYGPPAAGKDTVTAALRSADQRFEPVTKLKHGTGRSAGYRFVTAEELEDLRRQGR
IVVETRRYGNVYAVDDLSLTEPQRRGRVPVTHIGNVKDMRTLLNRSTSTAWLRVLLWVPR
DVCEQRSLARGDTDTAKRLAAWDETARDVRDSDVRDLFDLVIRTDLTDPATAAKQVAYAL
DSAPDIVGADELFATLGLGPDTAVARRNTSPRRG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccatcgttctgtacggaccaccggccgccggcaaggacaccgtgacggcagcc
ctgcgctcagccgatcagcgcttcgagccggtcaccaagctgaagcacgggacgggccgg
tctgccggttaccggttcgtcaccgccgaagagctcgaagacttgcgtcgccagggcagg
atcgtcgtggagacccggcgctacggcaacgtgtacgcggtcgacgacctctcgctcacg
gaacctcagcgtcgggggcgggttccggtcacccacatcggcaacgtcaaggacatgcgc
acgttgctgaaccggagtacgtccactgcgtggttacgcgtcctcctctgggtgccgcgc
gacgtgtgcgagcagcggtctctcgcacggggagacaccgacaccgcgaagcgactcgcc
gcctgggacgagacggcacgagatgtgcgcgactccgatgtgcgcgacctgttcgacctc
gttatccgtacggacctcaccgatccggcgaccgctgccaagcaggtcgcctacgcgctc
gacagcgcaccggacatcgtgggtgcggacgagctgttcgccacgctcggacttggcccg
gacacagccgtggccaggcggaacacgtcaccgcgtcgcgggtga

DBGET integrated database retrieval system