KEGG   Streptomyces pratensis: Sfla_1217
Entry
Sfla_1217         CDS       T01647                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00071  Fatty acid degradation
sfa00280  Valine, leucine and isoleucine degradation
sfa00281  Geraniol degradation
sfa00362  Benzoate degradation
sfa00592  alpha-Linolenic acid metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01212  Fatty acid metabolism
Module
sfa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sfla_1217
   00592 alpha-Linolenic acid metabolism
    Sfla_1217
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sfla_1217
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Sfla_1217
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sfla_1217
   00642 Ethylbenzene degradation
    Sfla_1217
Enzymes [BR:sfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     Sfla_1217
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: ADW02668
UniProt: E8VZZ3
Position
1426905..1428131
AA seq 408 aa
MPRTIRDVVFVDGVRTPFGKAGPKGIYHETRADDLVVKAIRELLRRNPDLDPAKIDEVAI
AATTQIGDQGLTLGRTAGILAGLPQSVPGYSIDRMCAGALTAVTSTAGSIAFGAYDVVIA
GGVEHMGRHPMGESVDPNPRLVSEKLVDESALFMGMTAENLHDRYPSITKQRADEYAVRS
QEKAAKAYANGKIQQDLVPVSVRRTNAEAGETGWGLVTADEPMRPGTTLESLAGLKTPFR
AHGRVTAGNAAGLNDGATASLLASEETARELGLPVKMRLVSYAFAGVEPEVMGYGPIPAT
EKALAKAGLSIEDIGLFEINEAFAVQVLAFLEHYGIADDDQRVNQYGGAIAYGHPLASSG
VRLMTQLARQFEEQPEVRYGLTTMCVGFGMGATVVWENPHFENAGGNK
NT seq 1227 nt   +upstreamnt  +downstreamnt
gtgcctcgtaccatccgggacgtcgtcttcgtcgacggcgtccgcaccccgttcggcaaa
gcgggcccgaagggcatctaccacgagacccgcgccgacgatctcgtcgtgaaggccatc
cgggagctgctgcgccgcaacccggacctggaccccgcgaagatcgacgaggtcgccatc
gccgcgaccacccagatcggcgaccagggcctcaccctcgggcgtaccgccgggatcctg
gccggtctgccgcagtcggtccccggctactccatcgaccgcatgtgcgcgggcgccctg
accgccgtcacctcgacggccggttccatcgccttcggcgcgtacgacgtcgtcatcgcc
ggcggtgtcgagcacatgggccgccacccgatgggcgagagcgtggaccccaacccgcgc
ctcgtgtcggagaagctggtcgacgagtccgccctcttcatgggcatgaccgcggagaac
ctgcacgacaggtacccctcgatcaccaagcagcgcgccgacgagtacgcggtccgctcg
caggagaaggccgccaaggcgtacgccaacggcaagatccagcaggacctggtgccggtg
tccgtgcgccgcaccaacgccgaggcgggcgagacgggctggggcctggtcaccgccgac
gagccgatgcgcccgggcaccaccctggaatccctggccggtctgaagaccccgttccgc
gcccacggccgcgtgacggccggtaacgccgccgggctcaacgacggcgccaccgcctcg
ctgctcgcgtccgaggagaccgcccgcgagctgggcctcccggtcaagatgcgtctcgtg
tcgtacgccttcgcgggcgtcgagcccgaggtcatgggctacggcccgatcccggcgacg
gagaaggccctggccaaggccggcctctccatcgaggacatcggtctcttcgagatcaac
gaggccttcgccgtgcaggtgctggccttcctggagcactacggcatcgccgacgacgac
cagcgcgtcaaccagtacggcggcgcgatcgcctacggtcacccgctcgcctcctccggc
gtccgcctgatgactcagctggcccgccagttcgaggagcagccggaggtccgttacggc
ctgacgaccatgtgcgtcggcttcggcatgggcgcgacggtcgtctgggagaacccgcac
ttcgagaacgccggaggcaacaagtga

DBGET integrated database retrieval system