KEGG   Streptomyces pratensis: Sfla_2157Help
Entry
Sfla_2157         CDS       T01647                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00300  Lysine biosynthesis
sfa01100  Metabolic pathways
sfa01120  Microbial metabolism in diverse environments
sfa01230  Biosynthesis of amino acids
Module
sfa_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sfla_2157
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sfla_2157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADW03590
UniProt: E8WES7
Position
complement(2599686..2600765)
Genome map
AA seq 359 aa AA seqDB search
MDGHTLDLSLDGPELTARLVDFPSVSGQEKDLADAVEAALRTLPHLTVDRHGNNVVARTR
LGRSERVVLAGHIDTVPIADNVPSRLDDDGVLWGCGTSDMKSGVAVQLRIAATVPEPNRD
LTFVFYDNEEVAAQHNGLGHVAEAHPDWLEADFAVLLEPSDAQVEGGCQGTVRVHLRLEG
ERAHSARSWMGSNAIHAAAPVLARLAAYEPRRPVIDGLEYREGLNAVGIEGGVATNVIPD
SCTVVVNYRYAPDRSPEEAEAHVREVFADCGVVGFTVDDHSGAAMPGLSHPAAKAFMEAV
GGTAQPKFGWTDVSRFGALGVPAVNYGPGDALFAHKRDEHVAVDRITHCEERLRSWLTS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggatggacacacgcttgacctctccctggacggtcccgagctcaccgcccggctggtc
gacttcccgtcggtcagcgggcaggagaaggacctcgccgacgccgtcgaggcggccctg
cgcacgctgccgcacctgaccgtcgaccgccacggcaacaacgtcgtggcgaggacccgg
ctgggccggtccgagcgtgtcgtcctggccggccacatcgacaccgtgccgatcgcggac
aacgtgccctcccgcctcgacgacgacggcgtgctgtgggggtgcggcacctccgacatg
aagtctggcgtggccgtccagctccggatcgcggcgaccgtgccggagcccaaccgcgac
ctgaccttcgtcttctacgacaacgaggaggtcgccgcccagcacaacggcctcggacac
gtggccgaagcgcaccccgactggctcgaagcggacttcgccgtcctgctggagccctcc
gacgcgcaggtcgagggcggctgccagggcaccgtgcgggtgcacctgcggctggagggc
gagcgggcccactccgcgcgcagctggatgggttccaacgcgatccacgccgccgccccg
gtgctggccaggctcgccgcgtacgagccgcgccgcccggtcatcgacggtctggagtac
cgcgaggggctcaacgccgtgggcatcgagggcggtgtcgccaccaacgtcatcccggac
tcctgcaccgtggtggtcaactaccggtacgcccccgatcggagccccgaggaggccgag
gcgcacgtcagggaggtcttcgcggactgcggcgtcgtcgggttcaccgtcgacgaccac
tccggcgccgccatgcccgggctctcgcatcccgcggccaaggcgttcatggaggcggtc
ggcggcacggcccagcccaagttcggctggaccgacgtctcccggttcggcgctctcggc
gttcccgcggtgaactacggtcccggggacgcgctgttcgcgcacaagcgggacgagcac
gtggcggtcgaccggatcacgcactgcgaggagcgtctgcgctcctggctcaccagctga

DBGET integrated database retrieval system