KEGG   Streptomyces pratensis: Sfla_2221Help
Entry
Sfla_2221         CDS       T01647                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00010  Glycolysis / Gluconeogenesis
sfa00030  Pentose phosphate pathway
sfa00051  Fructose and mannose metabolism
sfa00680  Methane metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
sfa01130  Biosynthesis of antibiotics
sfa01200  Carbon metabolism
Module
sfa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfla_2221
   00030 Pentose phosphate pathway
    Sfla_2221
   00051 Fructose and mannose metabolism
    Sfla_2221
  09102 Energy metabolism
   00680 Methane metabolism
    Sfla_2221
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Sfla_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX KH_1
Motif
Other DBs
NCBI-ProteinID: ADW03652
UniProt: E8WEY9
Position
2671192..2672226
Genome map
AA seq 344 aa AA seqDB search
MSEHHHLPSPLEVSPEAPDRNLALELVRVTEAAAMAAGRWVGRGDKIGADGAAVKAMRTL
VSTVSMNGIVVIGEGEKDEAPMLFNGERVGDGTGAEVDIAVDPIDGTTLNAKGMPNAIAV
LAAADRGSMFDPSAVFYMDKLVTGPEAADFVDINAPVSVNIRRVARAKNSAPEDVTVVIL
DRPRHDGVVKEIRETGARIKFISDGDVAGSIMAAREGTGVDLLMGIGGTPEGIISACAIK
CLGGVIQGKLWPKDEAERQRALDAGHDLDRVLSTDDLVSGDNVFFVATGITDGELLRGVR
YRAETATTESLVMRSKSGTIRRIDSTHRLSKLRAYSAIDFDRAQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcatcatcatctgccgtccccgctcgaggtctccccggaggctcccgaccgc
aacctggccctggagctggtgcgggtcaccgaggccgccgccatggccgcggggcgctgg
gtcggccgcggcgacaagatcggcgccgacggtgccgccgtgaaggccatgcgtacgctc
gtctccaccgtgtcgatgaacggcatcgtcgtcatcggtgagggcgagaaggacgaagcc
cccatgctgttcaacggcgagcgcgtcggcgacggcaccggggccgaggtcgacatcgcc
gtcgacccgatcgacggcaccacgctcaacgccaagggcatgcccaacgcgatcgccgta
ctggcggccgcggaccgcggctcgatgttcgacccgtccgcggtcttctacatggacaag
ctggtcaccggccccgaggcggccgacttcgtcgacatcaacgcaccggtgtccgtgaac
atccggcgcgtcgcgcgggccaagaactcggcccccgaggacgtcaccgtcgtcatcctg
gaccgcccccggcacgacggcgtcgtcaaggagatccgggagaccggcgccaggatcaag
ttcatctccgacggcgacgtggccggatcgatcatggccgcccgcgaggggaccggcgtc
gacctgctcatgggcatcggcggcacgcccgagggcatcatctcggcctgcgccataaag
tgcctcggcggcgtcatccagggcaagctctggcccaaggacgaggcggagcggcagcgt
gcgctggacgccggccacgacctggaccgggtcctgtcgacggacgacctcgtcagcggg
gacaacgtgttcttcgtcgccacggggatcaccgacggtgaactgctgcgcggtgtgcgg
taccgcgcggagacggccaccacggagtccctggtgatgcggtccaagtccggcacgatc
cgccggatcgactcgacgcaccggctctcgaagctccgcgcctacagcgcgatcgacttc
gaccgcgcccagtag

DBGET integrated database retrieval system