KEGG   Streptomyces pratensis: Sfla_2303Help
Entry
Sfla_2303         CDS       T01647                                 

Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
sfa  Streptomyces pratensis
Brite
KEGG Orthology (KO) [BR:sfa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sfla_2303
Enzymes [BR:sfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     Sfla_2303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ADW03732
UniProt: E8WG21
Position
complement(2759796..2760677)
Genome map
AA seq 293 aa AA seqDB search
MTEQLRLMAVHAHPDDESSKGAATMAKYVSEGVDVLVVTCTGGERGSILNPKLQGDAYIE
ANIHEVRKKEMDEAREILGVKQEWLGFVDSGLPEGDPLPPLPEGCFALEDDETAAGRLVA
KIRAFRPQVITTYDENGGYPHPDHIKTHTISMIAFEGAADTDRFPEAEFGPAWQPQKLYY
NQGFNKPRTVALHEALLARGLESPYGDWLERWKEFERAERTLTTHIPCDDFFEIRDKALI
AHATQIDPDGGWFRVPMDVQREVWPTEEYELAKSLVDTSLPESDLFAGIRDNA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgagcagctgagactgatggccgttcacgcccaccccgacgacgagtcgagcaag
ggcgcggccaccatggccaagtacgtgtccgagggggtggacgtcctggtagtcacctgc
acgggcggcgagcgggggtccatcctcaacccgaagctccagggggatgcctacatcgag
gcgaacatccacgaggtgcgcaagaaggagatggacgaggcccgggagatcctgggcgtc
aagcaggagtggctcggcttcgtcgactcgggtctccccgagggcgacccgctgcccccg
ctgcccgagggctgcttcgccctggaggacgacgagacggcggcggggcgtctcgtcgcg
aagatccgcgcgttccggccgcaggtgatcaccacctacgacgagaacggcgggtacccg
caccccgaccacatcaagacccacacgatctcgatgatcgcgttcgagggggccgcggac
accgacaggttccccgaggcggagttcggcccggcctggcagccgcagaagctctactac
aaccagggcttcaacaagccgcgcaccgtcgccctgcacgaggcgctcctcgcccgcggt
ctggagtccccgtacggcgactggctggagcgctggaaggagttcgagcgcgccgagcgc
acgctgaccacgcacatcccgtgcgacgacttcttcgagatccgcgacaaggcgctgatc
gcgcacgccacgcagatcgacccggacggcggctggttccgcgtgccgatggacgtccag
cgggaggtctggccgaccgaggagtacgagctcgccaagtccctggtcgatacctccctc
cccgagagcgacctcttcgcgggcatccgcgacaatgcctga

DBGET integrated database retrieval system