KEGG   Streptomyces pratensis: Sfla_3551Help
Entry
Sfla_3551         CDS       T01647                                 

Definition
(GenBank) Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
sfa  Streptomyces pratensis
Pathway
sfa00860  Porphyrin and chlorophyll metabolism
sfa01100  Metabolic pathways
sfa01110  Biosynthesis of secondary metabolites
sfa01120  Microbial metabolism in diverse environments
Module
sfa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sfla_3551
Enzymes [BR:sfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Sfla_3551
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sfla_3551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ADW04971
UniProt: E8VZ93
Position
4104734..4106401
Genome map
AA seq 555 aa AA seqDB search
MSPTGPVVSDFPVLSSGHVTFLGAGPGDPGLLTLRAVEALASADVLVAEPDVLDVVRCHA
RAGVSTPEMTVVDVASTPAGVPVLRDAANLVMEAAKGGRRVVRAVTGDPGLDGNTGAEML
ACAAAGVPFEVVPGIANAVGVPAYAGVPLRDAQGADVRFVDARTASDRCWSEVGASDATA
VVSTSLDSVAAAAGELVSAGRKPDTPLTVTIAGTTTRQRTWTATLGTIAQVLKQAKVLPS
PDGHLPVIAVVGERSSAAQRDQLAWFESKPLFGWKVLVPRTKEQAASLSDQLRSYGAVPH
EVPTIAVEPPRTPQQMERAVKGLVTGRYEWIAFTSVNAVKAVREKFEEYGLDARAFAGIK
VAAVGEQTGAALVDFGVKPDLMPSGEQSAAGLLEDWPPYDPVFDPIDRVFLPRADIATET
LVAGLIELGWEVDDVTAYRTVRASPPPADTREAIKGGGFDAVLFTSSSTVRNLVGIAGKP
HNVTVIACIGPATAKTAEEHGLRVDVLSPEPSVHKLAQALADFGAQRRDAAKEAGDPVTR
PSERRPGARRRRTTT
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
ttgagccccaccggccctgtcgtatccgacttccctgtcctgtcctcagggcatgtcacc
ttcctcggcgccggtcccggcgacccggggctgctgactctgcgcgccgtcgaggcgctt
gcgagcgcggacgtccttgtggccgaaccggacgttctcgacgtcgttcgctgccatgcg
cgggcaggggtaagcacgcctgagatgacggttgttgacgtggcgtcaacacccgccgga
gtacccgtcctcagggatgccgccaatcttgtcatggaggcagcgaagggcggcaggcgg
gtggtgcgtgccgtcacgggcgaccccggtctggacggcaacacgggcgccgagatgctc
gcctgcgctgccgcgggtgtgcctttcgaggtcgtgcccggcatcgcgaacgcggtcggt
gtgcccgcgtacgccggtgtgccgctgcgtgacgcgcagggcgccgacgtgcgcttcgtc
gacgcgcgtaccgcttcggaccgctgctggtccgaggtcggcgcgagcgacgcgacggcc
gtcgtgtcgacgtcgctcgactcggtcgccgcggccgcgggtgagctggtctcggccggg
cgcaagcccgacaccccgctcacggtcacgatcgccggtacgacgacccgccagcgcacc
tggacggcgaccctcgggacgatcgcccaggtcctgaagcaggcgaaggtcctcccgtcg
ccggacgggcacctgcccgtcatagccgtggtcggggagcgcagctccgcggcccagcgc
gaccagctcgcgtggttcgagtccaagccgctgttcggctggaaggtgctcgtgccgcgt
acgaaggagcaggcggcttcgctctccgaccaactgcgttcctacggtgccgtgccgcac
gaggtcccgacgatcgccgtcgagccgccgcgtacgccccagcagatggagcgggcggtc
aagggtctggtcacgggccggtacgagtggatcgcgttcacctcggtgaacgcggtgaag
gccgtgcgggagaagttcgaggagtacgggctcgacgcccgtgccttcgccgggatcaag
gtcgcggccgtcggtgagcagaccggtgcggctctggtcgacttcggtgtgaagcccgat
ctgatgccgtccggtgagcagtccgccgcgggtctgctggaggactggccgccgtacgac
ccggtcttcgacccgatcgaccgggtgttcctgccgcgcgccgacatcgccacggagacc
ctggtggccgggctcatcgagctgggctgggaggtcgacgacgtcaccgcgtaccgcacg
gtccgcgcctcgccgccgccggccgacacccgtgaggcgatcaagggcggcggtttcgac
gcggtgctcttcacctcgtcctcgaccgtccgcaacctggtcggtatcgcgggcaagccg
cacaacgtgacggtgatcgcctgcatcggtcccgccacggcgaagacggccgaggagcac
ggcctgcgggtcgacgtcctgtccccggagccgtcggtccacaagctggcccaggcgctg
gcggacttcggtgcgcagcgccgggacgctgcgaaggaggccggtgacccggtgacccgg
ccgagcgagcgtcgcccgggtgcgcggcgtcgccggacgaccacctga

DBGET integrated database retrieval system